RegulonDB RegulonDB 10.6.3: Gene Form
   

proV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proV proW proX nrdF H-NS H-NS IHF H-NS H-NS H-NS H-NS H-NS H-NS H-NS IHF H-NS terminator anti-terminator TSS_2992 TSS_2992 proVp3 proVp3 proVp2 proVp2 proVp1 proVp1

Gene      
Name: proV    Texpresso search in the literature
Synonym(s): ECK2671, EG10771, b2677, osrA, proU
Genome position(nucleotides): 2804815 --> 2806017 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.04
Note(s):
External database links:  
ASAP:
ABE-0008814
ECHOBASE:
EB0764
ECOCYC:
EG10771
ECOLIHUB:
proV
OU-MICROARRAY:
b2677
REGULONDB:
b2677
STRING:
511145.b2677
M3D: proV
COLOMBOS: proV
PortEco: b2677


Shine dalgarno      
Sequence: tagacaaataAAGGAAtctttctattgcATG


Product      
Name: glycine betaine ABC transporter ATP binding subunit ProV
Synonym(s): OsrA, ProU, ProV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 44.163
Isoelectric point: 5.219
Motif(s):
 
Type Positions Sequence
45 -> 192 KDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAF
29 -> 265 LSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFF
338 -> 393 GLDAALIDAPLAVDAQTPLSELLSHVGQAPCAVPVVDEDQQYVGIISKGMLLRALD
343 -> 400 LIDAPLAVDAQTPLSELLSHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNNG
165 -> 168 LSGG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0005275 - amine transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005034 - osmosensor activity
biological_process GO:0006865 - amino acid transport
GO:0015837 - amine transport
GO:0006972 - hyperosmotic response
GO:0031460 - glycine betaine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Doukyu N., et al., 2012
[2] Xu Y., et al., 2017
External database links:  
DIP:
DIP-10574N
ECOCYC:
PROV-MONOMER
ECOLIWIKI:
b2677
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR005892
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR000644
MINT:
MINT-1249790
MODBASE:
P14175
PFAM:
PF00571
PFAM:
PF00005
PRIDE:
P14175
PRODB:
PRO_000023602
PROSITE:
PS00211
PROSITE:
PS51371
PROSITE:
PS50893
PROTEINMODELPORTAL:
P14175
REFSEQ:
NP_417163
SMART:
SM00382
SMR:
P14175
SWISSMODEL:
P14175
UNIPROT:
P14175


Operon      
Name: proVWX         
Operon arrangement:
Transcription unit        Promoter
proVWX
proVWX
proVWX


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: H-NS


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2992 2805036 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Doukyu N., Ishikawa K., Watanabe R., Ogino H., 2012, Improvement in organic solvent tolerance by double disruptions of proV and marR genes in Escherichia coli., J Appl Microbiol 112(3):464-74

 [2] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB