RegulonDB RegulonDB 10.6.3: Gene Form
   

proW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proV proW proX nrdF H-NS H-NS IHF H-NS H-NS H-NS H-NS H-NS H-NS H-NS IHF H-NS terminator anti-terminator TSS_2992 TSS_2992 proVp3 proVp3 proVp2 proVp2 proVp1 proVp1

Gene      
Name: proW    Texpresso search in the literature
Synonym(s): ECK2672, EG10772, b2678, osrA, proU
Genome position(nucleotides): 2806010 --> 2807074 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.12
External database links:  
ASAP:
ABE-0008816
ECHOBASE:
EB0765
ECOCYC:
EG10772
ECOLIHUB:
proW
OU-MICROARRAY:
b2678
REGULONDB:
b2678
STRING:
511145.b2678
M3D: proW
COLOMBOS: proW
PortEco: b2678


Shine dalgarno      
Sequence: tagatcgtgaGGGGGTaaataATG


Product      
Name: glycine betaine ABC transporter membrane subunit ProW
Synonym(s): OsrA, ProU, ProW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.62
Isoelectric point: 9.677
Motif(s):
 
Type Positions Sequence
145 -> 324 AMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLT
163 -> 324 GLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLT
149 -> 169 LALVLTALLFCIVIGLPLGIW
100 -> 120 LLLGMPAPVAIIVFALIAWQI
122 -> 142 GVGMGVATLVSLIAIGAIGAW

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:1902495 - transmembrane transporter complex
molecular_function GO:0005515 - protein binding
GO:0005275 - amine transmembrane transporter activity
GO:0015226 - carnitine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0015837 - amine transport
GO:0006972 - hyperosmotic response
GO:0055085 - transmembrane transport
GO:0031460 - glycine betaine transport
GO:0015871 - choline transport
GO:1902603 - carnitine transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
PROW-MONOMER
ECOLIWIKI:
b2678
INTERPRO:
IPR035906
INTERPRO:
IPR000515
PFAM:
PF00528
PRIDE:
P14176
PRODB:
PRO_000023603
PROSITE:
PS50928
PROTEINMODELPORTAL:
P14176
REFSEQ:
NP_417164
SMR:
P14176
UNIPROT:
P14176


Operon      
Name: proVWX         
Operon arrangement:
Transcription unit        Promoter
proVWX
proVWX
proVWX


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2992 2805036 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB