RegulonDB RegulonDB 10.8: Gene Form
   

proX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygaY proW proX ygaZ ygaH proV TSS_2995 TSS_2995 TSS_2994 TSS_2994 ygaZp8 ygaZp8 TSS_2993 TSS_2993

Gene      
Name: proX    Texpresso search in the literature
Synonym(s): ECK2673, EG10773, b2679, osrA, proU
Genome position(nucleotides): 2807132 --> 2808124 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.57
External database links:  
ASAP:
ABE-0008818
CGSC:
35653
ECHOBASE:
EB0766
OU-MICROARRAY:
b2679
PortEco:
proX
STRING:
511145.b2679
COLOMBOS: proX


Shine dalgarno      
Sequence: ctgccaaaaaAAGGAAtaacaATG


Product      
Name: glycine betaine ABC transporter periplasmic binding protein ProX
Synonym(s): OsrA, ProU, ProX, glycine betaine binding protein (GBBP)
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 36.023
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
114 -> 254 AQGYLIDKKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNADTKLPNGANYGFPV
30 -> 312 TVNPVQSTITEETFQTLLVSRALEKLGYTVNKPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGAAQGYLIDKKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNADTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASEGDIQGHVDGWIK
252 -> 256 FPVST
22 -> 113 ADLPGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVNKPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGA
161 -> 163 WGC

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0050997 - quaternary ammonium group binding
biological_process GO:0006865 - amino acid transport
GO:0006972 - hyperosmotic response
GO:0055085 - transmembrane transport
GO:0031460 - glycine betaine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Breed J., et al., 2001
External database links:  
ECOCYC:
PROX-MONOMER
ECOLIWIKI:
b2679
INTERPRO:
IPR007210
MODBASE:
P0AFM2
PDB:
1R9L
PDB:
1R9Q
PFAM:
PF04069
PRIDE:
P0AFM2
PRODB:
PRO_000023604
REFSEQ:
NP_417165
SMR:
P0AFM2
SWISSMODEL:
P0AFM2
UNIPROT:
P0AFM2


Operon      
Name: proVWX         
Operon arrangement:
Transcription unit        Promoter
proVWX
proVWX
proVWX


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2993 2809569 forward nd [RS-EPT-CBR] [2]
  promoter ygaZp8 2809595 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2994 2809748 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2995 2809756 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Breed J., Kneip S., Gade J., Welte W., Bremer E., 2001, Purification, crystallization and preliminary crystallographic analysis of the periplasmic binding protein ProX from Escherichia coli., Acta Crystallogr D Biol Crystallogr 57(Pt 3):448-50

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB