RegulonDB RegulonDB 10.7: Gene Form
   

prs gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dauA prs ispE PurR anti-anti-terminator anti-terminator terminator prsp prsp TSS_1540 TSS_1540 TSS_1539 TSS_1539 TSS_1538 TSS_1538 TSS_1537 TSS_1537

Gene      
Name: prs    Texpresso search in the literature
Synonym(s): ECK1195, EG10774, b1207, dnaR, prsA
Genome position(nucleotides): 1260928 <-- 1261875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.53
External database links:  
ASAP:
ABE-0004054
CGSC:
357
ECHOBASE:
EB0767
ECOO157CYC:
PRSA
OU-MICROARRAY:
b1207
PORTECO:
prs
REGULONDB:
b1207
STRING:
511145.b1207
M3D: prs
COLOMBOS: prs
PortEco: b1207


Product      
Name: ribose-phosphate diphosphokinase
Synonym(s): DnaR, Prs, PrsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.218
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
4 -> 121 MKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVG
221 -> 221 D
2 -> 315 PDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRISNEESISAMFEH
127 -> 127 T
96 -> 97 RQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.3 - purine ribonucleotide biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0002189 - ribose phosphate diphosphokinase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004749 - ribose phosphate diphosphokinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0043531 - ADP binding
GO:0042301 - phosphate ion binding
biological_process GO:0008152 - metabolic process
GO:0006164 - purine nucleotide biosynthetic process
GO:0009116 - nucleoside metabolic process
GO:0009165 - nucleotide biosynthetic process
GO:0044249 - cellular biosynthetic process
GO:0016310 - phosphorylation
GO:0009156 - ribonucleoside monophosphate biosynthetic process
GO:0006015 - 5-phosphoribose 1-diphosphate biosynthetic process
GO:0034214 - protein hexamerization
Reference(s): [1] Ando H., et al., 1996
[2] Fang H., et al., 2013
[3] Hove-Jensen B. 1983
[4] Hove-Jensen B. 1996
[5] Karzai AW., et al., 2001
[6] Nakano H., et al., 2001
[7] Post DA., et al., 1996
[8] Sakakibara Y. 1992
[9] Sakakibara Y. 1992
[10] Sakakibara Y. 1995
[11] Sakakibara Y. 1993
[12] Sakakibara Y. 1996
[13] Sakakibara Y. 1997
[14] Shimaoka M., et al., 2007
External database links:  
DIP:
DIP-35839N
ECOCYC:
PRPPSYN-MONOMER
ECOLIWIKI:
b1207
INTERPRO:
IPR000836
INTERPRO:
IPR000842
INTERPRO:
IPR029099
INTERPRO:
IPR005946
INTERPRO:
IPR029057
INTERPRO:
IPR037515
MINT:
MINT-1221689
PANTHER:
PTHR10210
PDB:
4S2U
PFAM:
PF13793
PFAM:
PF14572
PRIDE:
P0A717
PRODB:
PRO_000023611
PROSITE:
PS00114
PROTEINMODELPORTAL:
P0A717
REFSEQ:
NP_415725
SMR:
P0A717
SWISSMODEL:
P0A717
UNIPROT:
P0A717


Operon      
Name: lolB-ispE-prs         
Operon arrangement:
Transcription unit        Promoter
prs
lolB-ispE-prs


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1537 1259525 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_1538 1260982 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_1539 1261162 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_1540 1261821 reverse nd [RS-EPT-CBR] [15]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ando H., Kitabatake M., Inokuchi H., 1996, 10Sa RNA complements the temperature-sensitive phenotype caused by a mutation in the phosphoribosyl pyrophosphate synthetase (prs) gene in Escherichia coli., Genes Genet Syst 71(1):47-50

 [2] Fang H., Xie X., Xu Q., Zhang C., Chen N., 2013, Enhancement of cytidine production by coexpression of gnd, zwf, and prs genes in recombinant Escherichia coli CYT15., Biotechnol Lett 35(2):245-51

 [3] Hove-Jensen B., 1983, Chromosomal location of the gene encoding phosphoribosylpyrophosphate synthetase in Escherichia coli., J Bacteriol 154(1):177-84

 [4] Hove-Jensen B., 1996, Phosphoribosyl diphosphate synthetase-independent NAD de novo synthesis in Escherichia coli: a new phenotype of phosphate regulon mutants., J Bacteriol 178(3):714-22

 [5] Karzai AW., Sauer RT., 2001, Protein factors associated with the SsrA.SmpB tagging and ribosome rescue complex., Proc Natl Acad Sci U S A 98(6):3040-4

 [6] Nakano H., Goto S., Nakayashiki T., Inokuchi H., 2001, Temperature-sensitive mutations in various genes of Escherichia coli K12 can be suppressed by the ssrA gene for 10Sa RNA (tmRNA)., Mol Genet Genomics 265(4):615-21

 [7] Post DA., Switzer RL., Hove-Jensen B., 1996, The defective phosphoribosyl diphosphate synthase in a temperature-sensitive prs-2 mutant of Escherichia coli is compensated by increased enzyme synthesis., Microbiology 142 ( Pt 2):359-65

 [8] Sakakibara Y., 1992, dnaR function of the prs gene of Escherichia coli in initiation of chromosome replication., J Mol Biol 226(4):989-96

 [9] Sakakibara Y., 1992, Novel Escherichia coli mutant, dnaR, thermosensitive in initiation of chromosome replication., J Mol Biol 226(4):979-87

 [10] Sakakibara Y., 1995, Suppression of thermosensitive initiation of DNA replication in a dnaR mutant of Escherichia coli by a rifampin resistance mutation in the rpoB gene., J Bacteriol 177(3):733-7

 [11] Sakakibara Y., 1993, Cooperation of the prs and dnaA gene products for initiation of chromosome replication in Escherichia coli., J Bacteriol 175(17):5559-65

 [12] Sakakibara Y., 1996, Rifampin-induced initiation of chromosome replication in dnaR-deficient Escherichia coli cells., J Bacteriol 178(5):1242-7

 [13] Sakakibara Y., 1997, Involvement of the ribulosephosphate epimerase gene in the dnaA and dnaR functions for initiation of chromosome replication in Escherichia coli., Mol Microbiol 24(4):793-801

 [14] Shimaoka M., Takenaka Y., Kurahashi O., Kawasaki H., Matsui H., 2007, Effect of amplification of desensitized purF and prs on inosine accumulation in Escherichia coli., J Biosci Bioeng 103(3):255-61

 [15] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB