RegulonDB RegulonDB 10.8: Gene Form
   

pspC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pspA pspC pspB pspD

Gene      
Name: pspC    Texpresso search in the literature
Synonym(s): ECK1301, EG10778, b1306
Genome position(nucleotides): 1369025 --> 1369384 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.28
External database links:  
ASAP:
ABE-0004391
CGSC:
32015
ECHOBASE:
EB0771
OU-MICROARRAY:
b1306
PortEco:
pspC
STRING:
511145.b1306
COLOMBOS: pspC


Product      
Name: phage shock protein C
Synonym(s): PspC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 13.517
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
8 -> 65 KKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIILSFALD
39 -> 59 ILVVLSIFFGLALFTLVAYII

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0010557 - positive regulation of macromolecule biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Engl C., et al., 2011
[2] Huvet M., et al., 2011
[3] Huvet M., et al., 2009
[4] Jovanovic G., et al., 2009
[5] Jovanovic G., et al., 2014
[6] Mehner D., et al., 2012
[7] Perez-Rueda E., et al., 2004
[8] Toni T., et al., 2011
[9] Weiner L., et al., 1991
External database links:  
DIP:
DIP-48215N
ECOCYC:
EG10778-MONOMER
ECOLIWIKI:
b1306
INTERPRO:
IPR007168
INTERPRO:
IPR014320
PFAM:
PF04024
PRIDE:
P0AFN2
PRODB:
PRO_000023616
REFSEQ:
NP_415822
SMR:
P0AFN2
UNIPROT:
P0AFN2


Operon      
Name: pspABCDE         
Operon arrangement:
Transcription unit        Promoter
pspABCDE
pspBCDE
pspE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, PspF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Engl C., Beek AT., Bekker M., de Mattos JT., Jovanovic G., Buck M., 2011, Dissipation of proton motive force is not sufficient to induce the phage shock protein response in Escherichia coli., Curr Microbiol 62(5):1374-85

 [2] Huvet M., Toni T., Sheng X., Thorne T., Jovanovic G., Engl C., Buck M., Pinney JW., Stumpf MP., 2011, The evolution of the phage shock protein response system: interplay between protein function, genomic organization, and system function., Mol Biol Evol 28(3):1141-55

 [3] Huvet M., Toni T., Tan H., Jovanovic G., Engl C., Buck M., Stumpf MP., 2009, Model-based evolutionary analysis: the natural history of phage-shock stress response., Biochem Soc Trans 37(Pt 4):762-7

 [4] Jovanovic G., Engl C., Buck M., 2009, Physical, functional and conditional interactions between ArcAB and phage shock proteins upon secretin-induced stress in Escherichia coli., Mol Microbiol 74(1):16-28

 [5] Jovanovic G., Mehta P., McDonald C., Davidson AC., Uzdavinys P., Ying L., Buck M., 2014, The N-terminal amphipathic helices determine regulatory and effector functions of phage shock protein A (PspA) in Escherichia coli., J Mol Biol 426(7):1498-511

 [6] Mehner D., Osadnik H., Lunsdorf H., Bruser T., 2012, The Tat system for membrane translocation of folded proteins recruits the membrane-stabilizing Psp machinery in Escherichia coli., J Biol Chem 287(33):27834-42

 [7] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [8] Toni T., Jovanovic G., Huvet M., Buck M., Stumpf MP., 2011, From qualitative data to quantitative models: analysis of the phage shock protein stress response in Escherichia coli., BMC Syst Biol 5:69

 [9] Weiner L., Brissette JL., Model P., 1991, Stress-induced expression of the Escherichia coli phage shock protein operon is dependent on sigma 54 and modulated by positive and negative feedback mechanisms., Genes Dev 5(10):1912-23


RegulonDB