RegulonDB RegulonDB 10.9: Gene Form
   

pspE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjM pspE pspD terminator anti-terminator anti-anti-terminator terminator TSS_1744 TSS_1744 ycjMp3 ycjMp3 ycjMp4 ycjMp4 TSS_1743 TSS_1743

Gene      
Name: pspE    Texpresso search in the literature
Synonym(s): ECK1303, EG10780, b1308
Genome position(nucleotides): 1369689 --> 1370003 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.79
External database links:  
ASAP:
ABE-0004397
CGSC:
32018
ECHOBASE:
EB0773
ECOLIHUB:
pspE
OU-MICROARRAY:
b1308
STRING:
511145.b1308
COLOMBOS: pspE


Product      
Name: thiosulfate sulfurtransferase PspE
Synonym(s): PspE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 11.475
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
1 -> 19 MFKKGLLALALVFSLPVFA
20 -> 104 AEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAMPKVKG
22 -> 93 HWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEILSEMGYTHVENAGG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016740 - transferase activity
GO:0004792 - thiosulfate sulfurtransferase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Luhachack L., et al., 2019
External database links:  
DIP:
DIP-10591N
ECOCYC:
EG10780-MONOMER
ECOLIWIKI:
b1308
INTERPRO:
IPR036873
INTERPRO:
IPR014323
INTERPRO:
IPR001763
MODBASE:
P23857
PDB:
2JTS
PDB:
2JTR
PDB:
2JTQ
PFAM:
PF00581
PRIDE:
P23857
PRODB:
PRO_000023618
PROSITE:
PS50206
REFSEQ:
NP_415824
SMART:
SM00450
SMR:
P23857
UNIPROT:
P23857


Operon      
Name: pspABCDE         
Operon arrangement:
Transcription unit        Promoter
pspABCDE
pspBCDE
pspE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, PspF


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1743 1369662 forward nd [RS-EPT-CBR] [2]
  promoter ycjMp4 1370003 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ycjMp3 1370185 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1744 1370189 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Luhachack L., Rasouly A., Shamovsky I., Nudler E., 2019, Transcription factor YcjW controls the emergency H2 S production in E. coli., Nat Commun 10(1):2868

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB