RegulonDB RegulonDB 10.7: Gene Form
   

pth gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ychF pth ychH CRP OxyR OxyR terminator anti-terminator anti-anti-terminator TSS_1536 TSS_1536 ychHp ychHp pthp pthp ychFp ychFp

Gene      
Name: pth    Texpresso search in the literature
Synonym(s): ECK1192, EG10785, b1204, rap
Genome position(nucleotides): 1257929 <-- 1258513 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.74
External database links:  
ASAP:
ABE-0004043
CGSC:
352
ECHOBASE:
EB0778
OU-MICROARRAY:
b1204
PORTECO:
pth
REGULONDB:
b1204
STRING:
511145.b1204
M3D: pth
COLOMBOS: pth
PortEco: b1204


Product      
Name: peptidyl-tRNA hydrolase
Synonym(s): Pth, Rap
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.082
Isoelectric point: 9.56
Motif(s):
 
Type Positions Sequence
5 -> 187 LIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNR
134 -> 134 R
101 -> 101 G

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0016787 - hydrolase activity
GO:0004045 - aminoacyl-tRNA hydrolase activity
biological_process GO:0006412 - translation
GO:0006515 - protein quality control for misfolded or incompletely synthesized proteins
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35932N
ECOCYC:
EG10785-MONOMER
ECOLIWIKI:
b1204
INTERPRO:
IPR036416
INTERPRO:
IPR001328
INTERPRO:
IPR018171
MINT:
MINT-1225563
MODBASE:
P0A7D1
PANTHER:
PTHR17224
PDB:
3VJR
PDB:
2PTH
PFAM:
PF01195
PRIDE:
P0A7D1
PRODB:
PRO_000023628
PROSITE:
PS01195
PROSITE:
PS01196
PROTEINMODELPORTAL:
P0A7D1
REFSEQ:
NP_415722
SMR:
P0A7D1
UNIPROT:
P0A7D1


Operon      
Name: pth-ychF         
Operon arrangement:
Transcription unit        Promoter
ychF
pth-ychF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1536 1258938 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB