RegulonDB RegulonDB 10.8: Gene Form
   

ptrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recB recC ptrA recD LexA ptrAp ptrAp TSS_3127 TSS_3127

Gene      
Name: ptrA    Texpresso search in the literature
Synonym(s): ECK2817, EG10786, b2821, ptr
Genome position(nucleotides): 2955996 <-- 2958884 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.16
External database links:  
ASAP:
ABE-0009252
CGSC:
351
ECHOBASE:
EB0779
OU-MICROARRAY:
b2821
PortEco:
ptrA
STRING:
511145.b2821
COLOMBOS: ptrA


Product      
Name: protease 3
Synonym(s): Pitrilysin, Protease pi, Ptr, PtrA, protease III
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 107.708
Isoelectric point: 5.906
Motif(s):
 
Type Positions Sequence
204 -> 204 E
681 -> 856 SITLKEVLAYRDALKSGARPEFMVIGNMTEAQATTLARDVQKQLGADGSEWCRNKDVVVDKKQSVIFEKAGNSTDSALAAVFVPTGYDEYTSSAYSSLLGQIVQPWFYNQLRTEEQLGYAVFAFPMSVGRQWGMGFLLQSNDKQPSFLWERYKAFFPTAEAKLRAMKPDEFAQIQQ
54 -> 191 VVLLVSDPQAVKSLSALVVPVGSLEDPEAYQGLAHYLEHMSLMGSKKYPQADSLAEYLKMHGGSHNASTAPYRTAFYLEVENDALPGAVDRLADAIAEPLLDKKYAERERNAVNAELTMARTRDGMRMAQVSAETINP
88 -> 88 H
91 -> 91 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0003824 - catalytic activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004222 - metalloendopeptidase activity
GO:0008237 - metallopeptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Anastasi A., et al., 1995
[2] Becker AB., et al., 1995
External database links:  
ECOCYC:
EG10786-MONOMER
ECOLIWIKI:
b2821
ECOO157CYC:
PTR-MONOMER
INTERPRO:
IPR032632
INTERPRO:
IPR011765
INTERPRO:
IPR001431
INTERPRO:
IPR007863
INTERPRO:
IPR011249
MODBASE:
P05458
PDB:
1Q2L
PFAM:
PF16187
PFAM:
PF05193
PFAM:
PF00675
PRIDE:
P05458
PRODB:
PRO_000023629
PROSITE:
PS00143
REFSEQ:
NP_417298
SMR:
P05458
UNIPROT:
P05458


Operon      
Name: ptrA-recBD         
Operon arrangement:
Transcription unit        Promoter
ptrA
ptrA-recBD


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3127 2951765 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Anastasi A., Barrett AJ., 1995, Pitrilysin., Methods Enzymol 248:684-92

 [2] Becker AB., Roth RA., 1995, Insulysin and pitrilysin: insulin-degrading enzymes of mammals and bacteria., Methods Enzymol 248:693-703

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB