RegulonDB RegulonDB 10.7: Gene Form
   

ptsG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuE ptsG ycfH Fis ArcA Mlc Fis CRP ArcA Fis ArcA SoxS CRP Fis Fis Mlc SgrS TSS_1432 (cluster) TSS_1432 (cluster) TSS_1431 TSS_1431 TSS_1430 TSS_1430 TSS_1429 (cluster) TSS_1429 (cluster) TSS_1428 TSS_1428 TSS_1427 TSS_1427 TSS_1426 (cluster) TSS_1426 (cluster) TSS_1425 (cluster) TSS_1425 (cluster) TSS_1424 TSS_1424 TSS_1423 TSS_1423 ptsGp1 ptsGp1 TSS_1421 TSS_1421 ptsGp2 ptsGp2

Gene      
Name: ptsG    Texpresso search in the literature
Synonym(s): CR, ECK1087, EG10787, b1101, car, cat, catB2, glcA, gptA, tgl, umg, umgC
Genome position(nucleotides): 1157869 --> 1159302 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.65
External database links:  
ASAP:
ABE-0003722
CGSC:
349
ECHOBASE:
EB0780
OU-MICROARRAY:
b1101
PORTECO:
ptsG
REGULONDB:
b1101
STRING:
511145.b1101
M3D: ptsG
COLOMBOS: ptsG
PortEco: b1101


Product      
Name: YnfM3'
Synonym(s): Car, Cat, EIIBglc, EIIBCglc, Enzyme IIBglc, Enzyme IIBCglc, GlcA, GptA, PtsG, Tgl, Umg, UmgC, cr, glucose-specific PTS enzyme IIBC component
Type: small RNA
Motif(s):
 
Type Positions Sequence
1 -> 388 MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMPLIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLGGIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVVLSFIWPPIGSAIQTFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRYMAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPIEFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIVGIGYAIVYYTIFRVLIKALDLKTPGRED
15 -> 35 SLMLPVSVLPIAGILLGVGSA
152 -> 172 FVPIISGLAAIFTGVVLSFIW
405 -> 436 LVAAFGGKENITNLDACITRLRVSVADVSKVD
51 -> 71 AGGSVFANMPLIFAIGVALGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0005355 - glucose transmembrane transporter activity
GO:0090564 - protein-phosphocysteine-glucose phosphotransferase system transporter activity
biological_process GO:0098708 - glucose import across plasma membrane
GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:1904659 - glucose transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Buhr A., et al., 1994
[2] Deutscher J., et al., 2006
[3] Eberstadt M., et al., 1996
[4] Erni B., et al., 1986
[5] Golic Grdadolnik S., et al., 1994
[6] Gu P., et al., 2019
[7] Gutknecht R., et al., 1998
[8] Jeckelmann JM., et al., 2011
[9] Kimata K., et al., 1998
[10] Kimata K., et al., 1997
[11] Lanz R., et al., 1998
[12] Lee SJ., et al., 2000
[13] Liang Q., et al., 2015
[14] Meadow ND., et al., 2005
[15] Niu H., et al., 2019
[16] Peterkofsky A., et al., 2001
[17] Plumbridge J. 1998
[18] Tanaka Y., et al., 2000
[19] Zeppenfeld T., et al., 2000
[20] Zurbriggen A., et al., 2010
External database links:  
DIP:
DIP-29833N
ECOCYC:
PTSG-MONOMER
ECOLIWIKI:
b1101
INTERPRO:
IPR013013
INTERPRO:
IPR004719
INTERPRO:
IPR011299
INTERPRO:
IPR036878
INTERPRO:
IPR001996
INTERPRO:
IPR003352
INTERPRO:
IPR018113
MODBASE:
P69786
PDB:
3BP8
PDB:
3BP3
PDB:
1O2F
PDB:
1IBA
PFAM:
PF02378
PFAM:
PF00367
PRIDE:
P69786
PRODB:
PRO_000023631
PROSITE:
PS51098
PROSITE:
PS51103
PROSITE:
PS01035
PROTEINMODELPORTAL:
P69786
REFSEQ:
NP_415619
SMR:
P69786
UNIPROT:
P69786


Operon      
Name: ptsG         
Operon arrangement:
Transcription unit        Promoter
ptsG
ptsG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, SoxS, Fis
Repressed by: Mlc, ArcA, Fis


Regulation by small RNA    
  Display Regulation
small RNA sgrS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1421 1157737 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1423 1158280 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1424 1158634 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1425 (cluster) 1158640 forward For this promoter, there
Read more >
[RS-EPT-CBR] [21]
  promoter TSS_1426 (cluster) 1158878 forward For this promoter, there
Read more >
[RS-EPT-CBR] [21]
  promoter TSS_1427 1158897 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1428 1158901 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1429 (cluster) 1158904 forward For this promoter, there
Read more >
[RS-EPT-CBR] [21]
  promoter TSS_1430 1158907 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1431 1159132 forward nd [RS-EPT-CBR] [21]
  promoter TSS_1432 (cluster) 1159175 forward For this promoter, there
Read more >
[RS-EPT-CBR] [21]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Buhr A., Flukiger K., Erni B., 1994, The glucose transporter of Escherichia coli. Overexpression, purification, and characterization of functional domains., J Biol Chem 269(38):23437-43

 [2] Deutscher J., Francke C., Postma PW., 2006, How phosphotransferase system-related protein phosphorylation regulates carbohydrate metabolism in bacteria., Microbiol Mol Biol Rev 70(4):939-1031

 [3] Eberstadt M., Grdadolnik SG., Gemmecker G., Kessler H., Buhr A., Erni B., 1996, Solution structure of the IIB domain of the glucose transporter of Escherichia coli., Biochemistry 35(35):11286-92

 [4] Erni B., Zanolari B., 1986, Glucose-permease of the bacterial phosphotransferase system. Gene cloning, overproduction, and amino acid sequence of enzyme IIGlc., J Biol Chem 261(35):16398-403

 [5] Golic Grdadolnik S., Eberstadt M., Gemmecker G., Kessler H., Buhr A., Erni B., 1994, The glucose transporter of Escherichia coli. Assignment of the 1H, 13C and 15N resonances and identification of the secondary structure of the soluble IIB domain., Eur J Biochem 219(3):945-52

 [6] Gu P., Niu H., Fan X., Gao J., Li Q., 2019, Engineering of phosphoenolpyruvate: carbohydrate phosphotransferase system increased acetate assimilation in Escherichia coli., 3 Biotech 9(3):77

 [7] Gutknecht R., Manni M., Mao Q., Erni B., 1998, The glucose transporter of Escherichia coli with circularly permuted domains is active in vivo and in vitro., J Biol Chem 273(40):25745-50

 [8] Jeckelmann JM., Harder D., Mari SA., Meury M., Ucurum Z., Muller DJ., Erni B., Fotiadis D., 2011, Structure and function of the glucose PTS transporter from Escherichia coli., J Struct Biol 176(3):395-403

 [9] Kimata K., Inada T., Tagami H., Aiba H., 1998, A global repressor (Mlc) is involved in glucose induction of the ptsG gene encoding major glucose transporter in Escherichia coli., Mol Microbiol 29(6):1509-19

 [10] Kimata K., Takahashi H., Inada T., Postma P., Aiba H., 1997, cAMP receptor protein-cAMP plays a crucial role in glucose-lactose diauxie by activating the major glucose transporter gene in Escherichia coli., Proc Natl Acad Sci U S A 94(24):12914-9

 [11] Lanz R., Erni B., 1998, The glucose transporter of the Escherichia coli phosphotransferase system. Mutant analysis of the invariant arginines, histidines, and domain linker., J Biol Chem 273(20):12239-43

 [12] Lee SJ., Boos W., Bouche JP., Plumbridge J., 2000, Signal transduction between a membrane-bound transporter, PtsG, and a soluble transcription factor, Mlc, of Escherichia coli., EMBO J 19(20):5353-61

 [13] Liang Q., Zhang F., Li Y., Zhang X., Li J., Yang P., Qi Q., 2015, Comparison of individual component deletions in a glucose-specific phosphotransferase system revealed their different applications., Sci Rep 5:13200

 [14] Meadow ND., Savtchenko RS., Nezami A., Roseman S., 2005, Transient state kinetics of enzyme IICBGlc, a glucose transporter of the phosphoenolpyruvate phosphotransferase system of Escherichia coli: equilibrium and second order rate constants for the glucose binding and phosphotransfer reactions., J Biol Chem 280(51):41872-80

 [15] Niu H., Li R., Gao J., Fan X., Li Q., Gu P., 2019, Different performance of Escherichia coli mutants with defects in the phosphoenolpyruvate: carbohydrate phosphotransferase system under low glucose condition., 3 Biotech 9(2):50

 [16] Peterkofsky A., Wang G., Garrett DS., Lee BR., Seok YJ., Clore GM., 2001, Three-dimensional structures of protein-protein complexes in the E. coli PTS., J Mol Microbiol Biotechnol 3(3):347-54

 [17] Plumbridge J., 1998, Expression of ptsG, the gene for the major glucose PTS transporter in Escherichia coli, is repressed by Mlc and induced by growth on glucose., Mol Microbiol 29(4):1053-63

 [18] Tanaka Y., Kimata K., Aiba H., 2000, A novel regulatory role of glucose transporter of Escherichia coli: membrane sequestration of a global repressor Mlc., EMBO J 19(20):5344-52

 [19] Zeppenfeld T., Larisch C., Lengeler JW., Jahreis K., 2000, Glucose transporter mutants of Escherichia coli K-12 with changes in substrate recognition of IICB(Glc) and induction behavior of the ptsG gene., J Bacteriol 182(16):4443-52

 [20] Zurbriggen A., Schneider P., Bahler P., Baumann U., Erni B., 2010, Expression, purification, crystallization and preliminary X-ray analysis of the EIICGlc domain of the Escherichia coli glucose transporter., Acta Crystallogr Sect F Struct Biol Cryst Commun 66(Pt 6):684-8

 [21] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB