RegulonDB RegulonDB 10.8: Gene Form
   

ptsH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptsI cysK ptsH CRP Cra NagC Mlc CRP TSS_2726 (cluster) TSS_2726 (cluster) TSS_2725 TSS_2725 TSS_2724 TSS_2724 TSS_2723 TSS_2723 TSS_2722 TSS_2722 TSS_2721 TSS_2721 TSS_2720 TSS_2720 TSS_2719 (cluster) TSS_2719 (cluster) crrpI crrpI crrp2 crrp2 TSS_2718 TSS_2718 TSS_2717 TSS_2717 TSS_2716 TSS_2716 TSS_2715 TSS_2715 TSS_2714 TSS_2714 TSS_2713 TSS_2713 TSS_2712 TSS_2712 TSS_2711 (cluster) TSS_2711 (cluster) TSS_2710 TSS_2710 TSS_2709 TSS_2709 TSS_2708 TSS_2708 TSS_2707 TSS_2707 TSS_2706 TSS_2706 TSS_2705 (cluster) TSS_2705 (cluster) TSS_2704 TSS_2704 TSS_2703 TSS_2703 TSS_2702 TSS_2702 ptsHp1 ptsHp1 ptsHp2 ptsHp2 TSS_2700 TSS_2700 TSS_2699 TSS_2699 TSS_2698 TSS_2698 ptsHp3 ptsHp3 ptsHp4 ptsHp4 ptsHp5 ptsHp5 TSS_2695 TSS_2695

Gene      
Name: ptsH    Texpresso search in the literature
Synonym(s): ECK2410, EG10788, b2415, ctr, hpr
Genome position(nucleotides): 2533764 --> 2534021 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.78
External database links:  
ASAP:
ABE-0007962
CGSC:
348
ECHOBASE:
EB0781
OU-MICROARRAY:
b2415
PortEco:
ptsH
STRING:
511145.b2415
COLOMBOS: ptsH


Product      
Name: phosphocarrier protein HPr
Synonym(s): Ctr, Hpr, PtsH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.119
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
72 -> 72 K
24 -> 24 K
27 -> 27 K
40 -> 40 K
3 -> 82 QQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  4 - transport --> 4.8.A - Accessory Factors Involved in Transport
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0030234 - enzyme regulator activity
GO:0004857 - enzyme inhibitor activity
GO:0016775 - phosphotransferase activity, nitrogenous group as acceptor
GO:0045152 - antisigma factor binding
biological_process GO:0033673 - negative regulation of kinase activity
GO:0043609 - regulation of carbon utilization
GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0045819 - positive regulation of glycogen catabolic process
GO:0051090 - regulation of DNA-binding transcription factor activity
GO:0018106 - peptidyl-histidine phosphorylation
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Anderson B., et al., 1971
[2] Ha JH., et al., 2018
[3] Jia Z., et al., 1993
[4] Koch S., et al., 1996
[5] Kundig W., et al., 1971
[6] Liang Q., et al., 2015
[7] Niu H., et al., 2019
[8] Reichenbach B., et al., 2007
[9] Seok YJ., et al., 1997
[10] Wasinger VC., et al., 1998
[11] van Nuland NA., et al., 1992
External database links:  
DIP:
DIP-35731N
ECOCYC:
PTSH-MONOMER
ECOLIWIKI:
b2415
INTERPRO:
IPR001020
INTERPRO:
IPR000032
INTERPRO:
IPR002114
INTERPRO:
IPR035895
MINT:
P0AA04
MODBASE:
P0AA04
PDB:
2JEL
PDB:
2LRK
PDB:
2LRL
PDB:
2XDF
PDB:
3CCD
PDB:
3EZB
PDB:
3EZE
PDB:
4XWJ
PDB:
5YA0
PDB:
5YA1
PDB:
5YA2
PDB:
1VRC
PDB:
1POH
PDB:
1PFH
PDB:
1OPD
PDB:
1J6T
PDB:
1HDN
PDB:
1GGR
PDB:
1CM3
PDB:
1CM2
PDB:
3EZA
PFAM:
PF00381
PRIDE:
P0AA04
PRINTS:
PR00107
PRODB:
PRO_000023632
PROSITE:
PS00369
PROSITE:
PS00589
PROSITE:
PS51350
REFSEQ:
NP_416910
SMR:
P0AA04
UNIPROT:
P0AA04


Operon      
Name: ptsHI-crr         
Operon arrangement:
Transcription unit        Promoter
ptsHI-crr
ptsHI-crr
ptsHI-crr
ptsHI-crr
ptsHI-crr
crr
crr


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Cra
Repressed by: CRP, NagC, Mlc, Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2695 2533311 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2698 2533520 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2699 2533592 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2700 2533595 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2702 2533654 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2703 2533658 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2704 2533688 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2705 (cluster) 2533691 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2706 2533744 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2707 2533746 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2708 2533930 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2709 2533978 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2710 2534042 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2711 (cluster) 2534053 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2712 2534171 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2713 2534767 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2714 2534771 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2715 2534776 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2716 2535322 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2717 2535452 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2718 2535474 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2719 (cluster) 2535671 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2720 2535696 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2721 2535734 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2722 2535767 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2723 2535778 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2724 2535782 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2725 2535785 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2726 (cluster) 2535792 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Anderson B., Weigel N., Kundig W., Roseman S., 1971, Sugar transport. 3. Purification and properties of a phosphocarrier protein (HPr) of the phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli., J Biol Chem 246(22):7023-33

 [2] Ha JH., Hauk P., Cho K., Eo Y., Ma X., Stephens K., Cha S., Jeong M., Suh JY., Sintim HO., Bentley WE., Ryu KS., 2018, Evidence of link between quorum sensing and sugar metabolism in Escherichia coli revealed via cocrystal structures of LsrK and HPr., Sci Adv 4(6):eaar7063

 [3] Jia Z., Quail JW., Waygood EB., Delbaere LT., 1993, The 2.0-A resolution structure of Escherichia coli histidine-containing phosphocarrier protein HPr. A redetermination., J Biol Chem 268(30):22490-501

 [4] Koch S., Sutrina SL., Wu LF., Reizer J., Schnetz K., Rak B., Saier MH., 1996, Identification of a site in the phosphocarrier protein, HPr, which influences its interactions with sugar permeases of the bacterial phosphotransferase system: kinetic analyses employing site-specific mutants., J Bacteriol 178(4):1126-33

 [5] Kundig W., Roseman S., 1971, Sugar transport. I. Isolation of a phosphotransferase system from Escherichia coli., J Biol Chem 246(5):1393-406

 [6] Liang Q., Zhang F., Li Y., Zhang X., Li J., Yang P., Qi Q., 2015, Comparison of individual component deletions in a glucose-specific phosphotransferase system revealed their different applications., Sci Rep 5:13200

 [7] Niu H., Li R., Gao J., Fan X., Li Q., Gu P., 2019, Different performance of Escherichia coli mutants with defects in the phosphoenolpyruvate: carbohydrate phosphotransferase system under low glucose condition., 3 Biotech 9(2):50

 [8] Reichenbach B., Breustedt DA., Stulke J., Rak B., Gorke B., 2007, Genetic dissection of specificity determinants in the interaction of HPr with enzymes II of the bacterial phosphoenolpyruvate:sugar phosphotransferase system in Escherichia coli., J Bacteriol 189(13):4603-13

 [9] Seok YJ., Sondej M., Badawi P., Lewis MS., Briggs MC., Jaffe H., Peterkofsky A., 1997, High affinity binding and allosteric regulation of Escherichia coli glycogen phosphorylase by the histidine phosphocarrier protein, HPr., J Biol Chem 272(42):26511-21

 [10] Wasinger VC., Humphery-Smith I., 1998, Small genes/gene-products in Escherichia coli K-12., FEMS Microbiol Lett 169(2):375-82

 [11] van Nuland NA., Grotzinger J., Dijkstra K., Scheek RM., Robillard GT., 1992, Determination of the three-dimensional solution structure of the histidine-containing phosphocarrier protein HPr from Escherichia coli using multidimensional NMR spectroscopy., Eur J Biochem 210(3):881-91

 [12] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB