RegulonDB RegulonDB 10.8: Gene Form
   

ptsI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptsI crr ptsH TSS_2732 TSS_2732 TSS_2731 TSS_2731 TSS_2730 (cluster) TSS_2730 (cluster) TSS_2729 (cluster) TSS_2729 (cluster) TSS_2728 (cluster) TSS_2728 (cluster) TSS_2727 TSS_2727 TSS_2726 (cluster) TSS_2726 (cluster) TSS_2725 TSS_2725 TSS_2724 TSS_2724 TSS_2723 TSS_2723 TSS_2722 TSS_2722 TSS_2721 TSS_2721 TSS_2720 TSS_2720 TSS_2719 (cluster) TSS_2719 (cluster) crrpI crrpI crrp2 crrp2 TSS_2718 TSS_2718 TSS_2717 TSS_2717 TSS_2716 TSS_2716 TSS_2715 TSS_2715 TSS_2714 TSS_2714 TSS_2713 TSS_2713 TSS_2712 TSS_2712 TSS_2711 (cluster) TSS_2711 (cluster) TSS_2710 TSS_2710 TSS_2709 TSS_2709 TSS_2708 TSS_2708

Gene      
Name: ptsI    Texpresso search in the literature
Synonym(s): ECK2411, EG10789, b2416, ctr
Genome position(nucleotides): 2534066 --> 2535793 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.65
External database links:  
ASAP:
ABE-0007967
CGSC:
347
ECHOBASE:
EB0782
OU-MICROARRAY:
b2416
PortEco:
ptsI
STRING:
511145.b2416
COLOMBOS: ptsI


Product      
Name: PTS enzyme I
Synonym(s): Ctr, EI, PtsI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 63.562
Isoelectric point: 4.495
Motif(s):
 
Type Positions Sequence
152 -> 222 IQDEVILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDA
231 -> 260 PTNEVIDKMRAVQEQVASEKAELAKLKDLP
21 -> 30 EDEIVIDRKK
144 -> 148 LKIID
250 -> 541 KAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWRAIRIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIRNTN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.8.A - Accessory Factors Involved in Transport
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0019197 - phosphoenolpyruvate-dependent sugar phosphotransferase complex
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000287 - magnesium ion binding
GO:0008965 - phosphoenolpyruvate-protein phosphotransferase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
External database links:  
DIP:
DIP-10603N
ECOCYC:
PTSI-MONOMER
ECOLIWIKI:
b2416
INTERPRO:
IPR023151
INTERPRO:
IPR018274
INTERPRO:
IPR015813
INTERPRO:
IPR008731
INTERPRO:
IPR008279
INTERPRO:
IPR006318
INTERPRO:
IPR000121
INTERPRO:
IPR036618
INTERPRO:
IPR024692
INTERPRO:
IPR036637
INTERPRO:
IPR040442
MINT:
P08839
MODBASE:
P08839
PANTHER:
PTHR22931:SF10
PDB:
3EZE
PDB:
3EZB
PDB:
2XDF
PDB:
2N5T
PDB:
2MP0
PDB:
2L5H
PDB:
2KX9
PDB:
2HWG
PDB:
2EZC
PDB:
2EZB
PDB:
2EZA
PDB:
1ZYM
PDB:
1EZD
PDB:
1EZC
PDB:
1EZB
PDB:
1EZA
PDB:
3EZA
PFAM:
PF05524
PFAM:
PF00391
PFAM:
PF02896
PRIDE:
P08839
PRINTS:
PR01736
PRODB:
PRO_000023633
PROSITE:
PS00370
PROSITE:
PS00742
REFSEQ:
NP_416911
SMR:
P08839
SWISSMODEL:
P08839
UNIPROT:
P08839


Operon      
Name: ptsHI-crr         
Operon arrangement:
Transcription unit        Promoter
ptsHI-crr
ptsHI-crr
ptsHI-crr
ptsHI-crr
ptsHI-crr
crr
crr


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Cra
Repressed by: CRP, NagC, Mlc, Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2708 2533930 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2709 2533978 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2710 2534042 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2711 (cluster) 2534053 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2712 2534171 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2713 2534767 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2714 2534771 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2715 2534776 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2716 2535322 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2717 2535452 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2718 2535474 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2719 (cluster) 2535671 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2720 2535696 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2721 2535734 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2722 2535767 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2723 2535778 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2724 2535782 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2725 2535785 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2726 (cluster) 2535792 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2727 2535802 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2728 (cluster) 2535812 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2729 (cluster) 2535819 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2730 (cluster) 2535831 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2731 2535839 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2732 2536064 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB