RegulonDB RegulonDB 10.8: Gene Form
   

purC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bamC ypfJ purC PurR anti-anti-terminator anti-terminator terminator purCp purCp TSS_2767 TSS_2767 TSS_2766 TSS_2766 tmcAp5 tmcAp5

Gene      
Name: purC    Texpresso search in the literature
Synonym(s): ECK2472, EG10791, ade, ade(g), b2476
Genome position(nucleotides): 2596905 <-- 2597618 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.24
Reference(s): [1] Parker J. 1984
[2] Tiedeman AA., et al., 1990
External database links:  
ASAP:
ABE-0008156
CGSC:
343
ECHOBASE:
EB0784
OU-MICROARRAY:
b2476
PortEco:
purC
STRING:
511145.b2476
COLOMBOS: purC


Product      
Name: phosphoribosylaminoimidazole-succinocarboxamide synthase
Synonym(s): Ade, PurC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.995
Isoelectric point: 4.787
Motif(s):
 
Type Positions Sequence
7 -> 231 LYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEFGLYKGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004639 - phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
GO:0042802 - identical protein binding
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0009236 - cobalamin biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
External database links:  
DIP:
DIP-35900N
ECOCYC:
SAICARSYN-MONOMER
ECOLIWIKI:
b2476
INTERPRO:
IPR028923
INTERPRO:
IPR033934
INTERPRO:
IPR018236
INTERPRO:
IPR001636
MINT:
MINT-1257522
MODBASE:
P0A7D7
PANTHER:
PTHR43599:SF3
PDB:
2GQR
PDB:
2GQS
PFAM:
PF01259
PRIDE:
P0A7D7
PRODB:
PRO_000023638
PROSITE:
PS01057
PROSITE:
PS01058
REFSEQ:
NP_416971
SMR:
P0A7D7
SWISSMODEL:
P0A7D7
UNIPROT:
P0A7D7


Operon      
Name: purC         
Operon arrangement:
Transcription unit        Promoter
purC


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tmcAp5 2595938 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2766 2596763 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2767 2597654 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Parker J., 1984, Identification of the purC gene product of Escherichia coli., J Bacteriol 157(3):712-7

 [2] Tiedeman AA., DeMarini DJ., Parker J., Smith JM., 1990, DNA sequence of the purC gene encoding 5'-phosphoribosyl-5-aminoimidazole-4-N-succinocarboxamide synthetase and organization of the dapA-purC region of Escherichia coli K-12., J Bacteriol 172(10):6035-41

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB