RegulonDB RegulonDB 10.8: Gene Form
   

purE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purK ybcF lpxH purE ylbF PurR purEp purEp

Gene      
Name: purE    Texpresso search in the literature
Synonym(s): ECK0516, EG10793, Pur2, ade, ade(f), ade3, b0523
Genome position(nucleotides): 552591 <-- 553100 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.02
External database links:  
ASAP:
ABE-0001796
CGSC:
341
ECHOBASE:
EB0786
OU-MICROARRAY:
b0523
PortEco:
purE
STRING:
511145.b0523
COLOMBOS: purE


Shine dalgarno      
Sequence: ttgtgcaccaCAGGAGttttaagacgCAT


Product      
Name: N5-carboxyaminoimidazole ribonucleotide mutase
Synonym(s): AIR carboxylase subunit, Ade, PurE, catalytic subunit, AIR carboxylase, purE1 peptide
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.78
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
9 -> 157 RVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTD
2 -> 169 SSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0042802 - identical protein binding
GO:0034023 - 5-(carboxyamino)imidazole ribonucleotide mutase activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
External database links:  
DIP:
DIP-10610N
ECOCYC:
PURE-MONOMER
ECOLIWIKI:
b0523
INTERPRO:
IPR000031
INTERPRO:
IPR035893
INTERPRO:
IPR033747
INTERPRO:
IPR024694
PDB:
2NSJ
PDB:
2NSL
PDB:
1D7A
PDB:
2ATE
PDB:
2NSH
PDB:
1QCZ
PFAM:
PF00731
PRIDE:
P0AG18
PRODB:
PRO_000023640
REFSEQ:
NP_415056
SMART:
SM01001
SMR:
P0AG18
SWISSMODEL:
P0AG18
UNIPROT:
P0AG18


Operon      
Name: purEK         
Operon arrangement:
Transcription unit        Promoter
purEK


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB