RegulonDB RegulonDB 10.8: Gene Form
   

purK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purK ybcF lpxH purE ylbF PurR purEp purEp

Gene      
Name: purK    Texpresso search in the literature
Synonym(s): ECK0515, EG10796, b0522, purE2
Genome position(nucleotides): 551527 <-- 552594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.46
External database links:  
ASAP:
ABE-0001794
CGSC:
17995
ECHOBASE:
EB0789
OU-MICROARRAY:
b0522
PortEco:
purK
STRING:
511145.b0522
COLOMBOS: purK


Shine dalgarno      
Sequence: ccggacccgcGAGGTGcggCAT


Product      
Name: 5-(carboxyamino)imidazole ribonucleotide synthase
Synonym(s): CO2 subunit, AIR carboxylase, PurK, purE2 peptide
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.461
Isoelectric point: 5.792
Motif(s):
 
Type Positions Sequence
88 -> 254 DKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGA
153 -> 156 EQGI
64 -> 65 RH
84 -> 267 KQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAIT
280 -> 329 SVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004638 - phosphoribosylaminoimidazole carboxylase activity
GO:0042803 - protein homodimerization activity
GO:0034028 - 5-(carboxyamino)imidazole ribonucleotide synthase activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
External database links:  
ECOCYC:
PURK-MONOMER
ECOLIWIKI:
b0522
INTERPRO:
IPR011054
INTERPRO:
IPR013815
INTERPRO:
IPR005875
INTERPRO:
IPR016185
INTERPRO:
IPR040686
INTERPRO:
IPR003135
INTERPRO:
IPR011761
MODBASE:
P09029
PDB:
3ETH
PDB:
1B6S
PDB:
1B6R
PDB:
3ETJ
PFAM:
PF02222
PFAM:
PF17769
PRIDE:
P09029
PRODB:
PRO_000023641
PROSITE:
PS50975
REFSEQ:
NP_415055
SMR:
P09029
UNIPROT:
P09029


Operon      
Name: purEK         
Operon arrangement:
Transcription unit        Promoter
purEK


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB