RegulonDB RegulonDB 10.8: Gene Form
   

purL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purL mltF glmY tadA PurR GlrR GlrR IHF GlrR IHF mltFp mltFp purLp purLp TSS_2850 TSS_2850 glmYp2 glmYp2 glmYp1 glmYp1

Gene      
Name: purL    Texpresso search in the literature
Synonym(s): ECK2555, EG10797, b2557, purI
Genome position(nucleotides): 2691656 <-- 2695543 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.89
External database links:  
ASAP:
ABE-0008412
CGSC:
336
ECHOBASE:
EB0790
OU-MICROARRAY:
b2557
PortEco:
purL
STRING:
511145.b2557
COLOMBOS: purL


Product      
Name: phosphoribosylformylglycinamide synthetase
Synonym(s): PurI, PurL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 141.402
Isoelectric point: 5.092
Motif(s):
 
Type Positions Sequence
172 -> 220 IDANLRLGLALAEDEIDYLQDAFTKLGRNPNDIELYMFAQANSEHCRHK
432 -> 589 VGAKLVVLGGPAMNIGLGGGAASSMASGQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVSDGGRGGKFELREILSDEPGMSPLEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAVIGEATEELHLSLH
36 -> 150 EYVHFADLNAPLNDDEHAQLERLLKYGPALASHAPQGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVNRLERGVAYYIEAGTLTNEQWQQVTAELHDRMMETVFFALDDAEQLF
1039 -> 1292 RPKVAVLREQGVNSHVEMAAAFHRAGFDAIDVHMSDLLTGRTGLEDFHALVACGGFSYGDVLGAGEGWAKSILFNDRVRDEFATFFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFVRNTSDRFEARFSLVEVTQSPSLLLQGMVGSQMPIAVSHGEGRVEVRDAAHLAALESKGLVALRYVDNFGKVTETYPANPNGSPNGITAVTTESGRVTIMMPHPERVFRTVSNSWHPENWGEDGPWMRIFRNARK
307 -> 318 GAATGSGGEIRD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004642 - phosphoribosylformylglycinamidine synthase activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0006189 - 'de novo' IMP biosynthetic process
GO:0009113 - purine nucleobase biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10614N
ECOCYC:
FGAMSYN-MONOMER
ECOLIWIKI:
b2557
INTERPRO:
IPR036676
INTERPRO:
IPR041609
INTERPRO:
IPR040707
INTERPRO:
IPR036921
INTERPRO:
IPR036604
INTERPRO:
IPR029062
INTERPRO:
IPR017926
INTERPRO:
IPR010918
INTERPRO:
IPR010073
MINT:
MINT-1262623
MODBASE:
P15254
PANTHER:
PTHR10099:SF5
PFAM:
PF18076
PFAM:
PF02769
PFAM:
PF18072
PRIDE:
P15254
PROSITE:
PS51273
REFSEQ:
YP_026170
SMR:
P15254
SWISSMODEL:
P15254
UNIPROT:
P15254


Operon      
Name: purL         
Operon arrangement:
Transcription unit        Promoter
purL


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2850 2694924 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB