RegulonDB RegulonDB 10.9: Gene Form
   

purR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhC purR ydhB cydH PurR PurR Fur ydhCp6 ydhCp6 ydhCp1 ydhCp1 ydhCp5 ydhCp5 ydhBp2 ydhBp2 purRp purRp TSS_1946 TSS_1946 TSS_1945 TSS_1945 TSS_1944 TSS_1944

Gene      
Name: purR    Texpresso search in the literature
Synonym(s): ECK1654, EG10800, b1658
Genome position(nucleotides): 1737844 --> 1738869 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.8
External database links:  
ASAP:
ABE-0005545
CGSC:
17989
ECHOBASE:
EB0793
ECOLIHUB:
purR
OU-MICROARRAY:
b1658
STRING:
511145.b1658
COLOMBOS: purR


Product      
Name: DNA-binding transcriptional repressor PurR
Synonym(s): PurR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 38.175
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
4 -> 23 IKDVAKRANVSTTTVSHVIN
190 -> 190 R
2 -> 341 ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
3 -> 48 TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPS
48 -> 56 SAVARSLKV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042803 - protein homodimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0002057 - guanine binding
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:1900372 - negative regulation of purine nucleotide biosynthetic process
Reference(s): [1] Meng LM., et al., 1990
[2] Rolfes RJ., et al., 1990
[3] Rolfes RJ., et al., 1988
External database links:  
DIP:
DIP-35931N
ECOCYC:
PD00219
ECOLIWIKI:
b1658
INTERPRO:
IPR023588
INTERPRO:
IPR010982
INTERPRO:
IPR000843
INTERPRO:
IPR028082
PDB:
1PRU
PDB:
1PRV
PDB:
1QP0
PDB:
1QP4
PDB:
1QP7
PDB:
1QPZ
PDB:
1QQA
PDB:
1QQB
PDB:
1VPW
PDB:
1WET
PDB:
1ZAY
PDB:
2PUA
PDB:
2PUB
PDB:
2PUC
PDB:
2PUD
PDB:
2PUE
PDB:
2PUF
PDB:
2PUG
PDB:
1PNR
PDB:
1JHZ
PDB:
1JH9
PDB:
1JFT
PDB:
1JFS
PDB:
1DBQ
PDB:
1BDI
PDB:
1BDH
PFAM:
PF13377
PFAM:
PF00356
PRIDE:
P0ACP7
PRINTS:
PR00036
PRODB:
PRO_000023644
PROSITE:
PS00356
PROSITE:
PS50932
REFSEQ:
NP_416175
SMART:
SM00354
SMR:
P0ACP7
UNIPROT:
P0ACP7


Operon      
Name: purR         
Operon arrangement:
Transcription unit        Promoter
purR


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1944 1737577 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1945 1737583 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1946 1737585 reverse nd [RS-EPT-CBR] [4]
  promoter ydhBp2 1739809 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydhCp5 1739849 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydhCp1 1739855 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydhCp6 1739878 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Meng LM., Kilstrup M., Nygaard P., 1990, Autoregulation of PurR repressor synthesis and involvement of purR in the regulation of purB, purC, purL, purMN and guaBA expression in Escherichia coli., Eur J Biochem 187(2):373-9

 [2] Rolfes RJ., Zalkin H., 1990, Autoregulation of Escherichia coli purR requires two control sites downstream of the promoter., J Bacteriol 172(10):5758-66

 [3] Rolfes RJ., Zalkin H., 1988, Escherichia coli gene purR encoding a repressor protein for purine nucleotide synthesis. Cloning, nucleotide sequence, and interaction with the purF operator., J Biol Chem 263(36):19653-61

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB