RegulonDB RegulonDB 10.6.3: Gene Form
   

putA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

putA rutR ymdG CRP PutA CRP PutA PutA PutA BasR PutA putAp putAp

Gene      
Name: putA    Texpresso search in the literature
Synonym(s): ECK1005, EG10801, b1014, poaA, putC
Genome position(nucleotides): 1074920 <-- 1078882 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.98
External database links:  
ASAP:
ABE-0003424
CGSC:
333
ECHOBASE:
EB0794
ECOCYC:
EG10801
ECOLIHUB:
putA
OU-MICROARRAY:
b1014
REGULONDB:
b1014
STRING:
511145.b1014
M3D: putA
COLOMBOS: putA
PortEco: b1014


Product      
Name: fused DNA-binding transcriptional repressor / proline dehydrogenase / 1-pyrroline-5-carboxylate dehydrogenase PutA
Synonym(s): PoaA, PutA, PutC, proline utilization A
Sequence: Get amino acid sequence Fasta Format
Regulator Family: PutA
Cellular location: inner membrane,cytosol
Molecular weight: 143.815
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
89 -> 136 SVSRAAITAAYRRPETEAVSMLLEQARLPQPVAEQAHKLAYQLADKLR
653 -> 1119 QPVAAGEMSPVINPAEPKDIVGYVREATPREVEQALESAVNNAPIWFATPPAERAAILHRAAVLMESQMQQLIGILVREAGKTFSNAIAEVREAVDFLHYYAGQVRDDFANETHRPLGPVVCISPWNFPLAIFTGQIAAALAAGNSVLAKPAEQTPLIAAQGIAILLEAGVPPGVVQLLPGRGETVGAQLTGDDRVRGVMFTGSTEVATLLQRNIASRLDAQGRPIPLIAETGGMNAMIVDSSALTEQVVVDVLASAFDSAGQRCSALRVLCLQDEIADHTLKMLRGAMAECRMGNPGRLTTDIGPVIDSEAKANIERHIQTMRSKGRPVFQAVRENSEDAREWQSGTFVAPTLIELDDFAELQKEVFGPVLHVVRYNRNQLPELIEQINASGYGLTLGVHTRIDETIAQVTGSAHVGNLYVNRNMVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLANRPESALA
228 -> 574 LSRSLNRIIGKSGEPLIRKGVDMAMRLMGEQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAQAYMVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINIDAEESDRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLIDLATRSRRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRRLLENGANTSFVNRIADTS
531 -> 531 G
270 -> 569 ANARKLEEKGFRYSYDMLGEAALTAADAQAYMVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLARQYDIGINIDAEESDRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLIDLATRSRRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRRLLENGANTSFVNR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0009898 - cytoplasmic side of plasma membrane
molecular_function GO:0003677 - DNA binding
GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0003842 - 1-pyrroline-5-carboxylate dehydrogenase activity
GO:0003700 - DNA-binding transcription factor activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004657 - proline dehydrogenase activity
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0000986 - bacterial-type proximal promoter sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0008152 - metabolic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0006560 - proline metabolic process
GO:0006561 - proline biosynthetic process
GO:0006979 - response to oxidative stress
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0055114 - oxidation-reduction process
GO:0010133 - proline catabolic process to glutamate
Note(s): Note(s): ...[more].
Reference(s): [1] Becker DF., et al., 2001
External database links:  
DIP:
DIP-10620N
ECOCYC:
PUTA-MONOMER
ECOLIWIKI:
B1014
INTERPRO:
IPR015590
INTERPRO:
IPR013321
INTERPRO:
IPR010985
INTERPRO:
IPR005933
INTERPRO:
IPR002872
INTERPRO:
IPR016160
INTERPRO:
IPR025703
INTERPRO:
IPR016162
INTERPRO:
IPR016161
INTERPRO:
IPR024090
INTERPRO:
IPR029510
INTERPRO:
IPR029041
INTERPRO:
IPR016163
INTERPRO:
IPR024082
INTERPRO:
IPR024089
MINT:
P09546
MODBASE:
P09546
PDB:
2FZN
PDB:
2FZM
PDB:
2AY0
PDB:
1TJ2
PDB:
1TJ1
PDB:
1TJ0
PDB:
1TIW
PDB:
3E2R
PDB:
3E2S
PDB:
3ITG
PDB:
4JNY
PDB:
4JNZ
PDB:
4O8A
PDB:
2GPE
PDB:
3E2Q
PDB:
2RBF
PFAM:
PF14850
PFAM:
PF01619
PFAM:
PF00171
PRIDE:
P09546
PRODB:
PRO_000023647
PROSITE:
PS00070
PROSITE:
PS00687
PROTEINMODELPORTAL:
P09546
REFSEQ:
NP_415534
SMR:
P09546
UNIPROT:
P09546


Operon      
Name: putA         
Operon arrangement:
Transcription unit        Promoter
putA


Transcriptional Regulation      
Display Regulation             
Activated by: MarA
Repressed by: BasR, PutA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Becker DF., Thomas EA., 2001, Redox properties of the PutA protein from Escherichia coli and the influence of the flavin redox state on PutA-DNA interactions., Biochemistry 40(15):4714-21


RegulonDB