RegulonDB RegulonDB 10.9: Gene Form
   

pyrI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrB pyrI ridA Lrp anti-anti-terminator anti-terminator terminator TSS_5093 TSS_5093 TSS_5092 (cluster) TSS_5092 (cluster) TSS_5091 TSS_5091 TSS_5090 (cluster) TSS_5090 (cluster) TSS_5089 TSS_5089 ridAp ridAp TSS_5088 TSS_5088 TSS_5087 TSS_5087

Gene      
Name: pyrI    Texpresso search in the literature
Synonym(s): ECK4239, EG10811, b4244
Genome position(nucleotides): 4470986 <-- 4471447 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.48
External database links:  
ASAP:
ABE-0013889
CGSC:
323
ECHOBASE:
EB0804
ECOLIHUB:
pyrI
OU-MICROARRAY:
b4244
STRING:
511145.b4244
COLOMBOS: pyrI


Product      
Name: aspartate carbamoyltransferase, PyrI subunit
Synonym(s): PyrI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 17.121
Isoelectric point: 7.454
Motif(s):
 
Type Positions Sequence
102 -> 148 RIDNVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHN
2 -> 153 THDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
7 -> 96 LQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0009347 - aspartate carbamoyltransferase complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
biological_process GO:0006221 - pyrimidine nucleotide biosynthetic process
GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic process
Reference(s): [1] Weber K. 1968
External database links:  
DIP:
DIP-35088N
ECOCYC:
ASPCARBREG-MONOMER
ECOLIWIKI:
b4244
INTERPRO:
IPR002801
INTERPRO:
IPR020542
INTERPRO:
IPR036793
INTERPRO:
IPR036792
INTERPRO:
IPR020545
MINT:
P0A7F3
PANTHER:
PTHR35805
PDB:
1D09
PDB:
1EZZ
PDB:
1F1B
PDB:
1I5O
PDB:
1NBE
PDB:
1Q95
PDB:
1R0B
PDB:
1R0C
PDB:
1RAA
PDB:
1RAB
PDB:
1RAC
PDB:
1RAD
PDB:
1RAE
PDB:
1RAF
PDB:
1RAG
PDB:
1RAH
PDB:
1RAI
PDB:
1SKU
PDB:
1TTH
PDB:
1TU0
PDB:
1TUG
PDB:
1XJW
PDB:
1ZA1
PDB:
1ZA2
PDB:
2A0F
PDB:
2AIR
PDB:
2AT1
PDB:
2ATC
PDB:
2FZC
PDB:
2FZG
PDB:
2FZK
PDB:
2H3E
PDB:
2HSE
PDB:
2IPO
PDB:
2QG9
PDB:
2QGF
PDB:
3AT1
PDB:
3D7S
PDB:
3MPU
PDB:
4AT1
PDB:
4E2F
PDB:
4F04
PDB:
4FYV
PDB:
4FYW
PDB:
4FYX
PDB:
4FYY
PDB:
4WTO
PDB:
5AT1
PDB:
6AT1
PDB:
6KJ8
PDB:
6KJA
PDB:
7AT1
PDB:
8AT1
PDB:
8ATC
PDB:
9ATC
PDB:
1ACM
PDB:
1AT1
PFAM:
PF01948
PFAM:
PF02748
PRIDE:
P0A7F3
PRODB:
PRO_000023664
REFSEQ:
NP_418665
SMR:
P0A7F3
UNIPROT:
P0A7F3


Operon      
Name: pyrLBI         
Operon arrangement:
Transcription unit        Promoter
pyrLBI
pyrLBI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5087 4470941 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5088 4470944 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5089 4471479 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5090 (cluster) 4471486 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_5091 4471513 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5092 (cluster) 4471516 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_5093 4471843 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Weber K., 1968, New structural model of E. coli aspartate transcarbamylase and the amino-acid sequence of the regulatory polypeptide chain., Nature 218(5147):1116-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB