RegulonDB RegulonDB 10.9: Gene Form
   

rbsD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kup rbsA rbsD RbsR CRP FNR terminator anti-terminator anti-anti-terminator rbsDp rbsDp

Gene      
Name: rbsD    Texpresso search in the literature
Synonym(s): ECK3742, EG10817, b3748, rbsP
Genome position(nucleotides): 3933351 --> 3933770 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.62
Reference(s): [1] Bell AW., et al., 1986
External database links:  
ASAP:
ABE-0012256
CGSC:
314
ECHOBASE:
EB0810
ECOLIHUB:
rbsD
OU-MICROARRAY:
b3748
STRING:
511145.b3748
COLOMBOS: rbsD


Product      
Name: D-ribose pyranase
Synonym(s): RbsD, RbsP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.292
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
20 -> 20 H
128 -> 130 YAN
106 -> 106 H
1 -> 138 MKKGTVLNSDISSVISRLGHTDTLVVCDAGLPIPKSTTRIDMALTQGVPSFMQVLGVVTNEMQVEAAIIAEEIKHHNPQLHETLLTHLEQLQKHQGNTIEIRYTTHEQFKQQTAESQAVIRSGECSPYANIILCAGVT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0062193 - D-ribose pyranase activity
GO:0016853 - isomerase activity
GO:0016866 - intramolecular transferase activity
GO:0048029 - monosaccharide binding
GO:0042802 - identical protein binding
GO:0016872 - intramolecular lyase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0005996 - monosaccharide metabolic process
GO:0019303 - D-ribose catabolic process
Note(s): Note(s): ...[more].
Reference(s): [2] Lalaouna D., et al., 2015
[3] Lease RA., et al., 1998
[4] Shimada T., et al., 2013
External database links:  
ECOCYC:
EG10817-MONOMER
ECOLIWIKI:
b3748
INTERPRO:
IPR023750
INTERPRO:
IPR023064
INTERPRO:
IPR007721
MODBASE:
P04982
PANTHER:
PTHR37831
PFAM:
PF05025
PRIDE:
P04982
PRODB:
PRO_000023685
REFSEQ:
NP_418204
SMR:
P04982
UNIPROT:
P04982


Operon      
Name: rbsDACBKR         
Operon arrangement:
Transcription unit        Promoter
rbsDACBKR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: RbsR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Bell AW., Buckel SD., Groarke JM., Hope JN., Kingsley DH., Hermodson MA., 1986, The nucleotide sequences of the rbsD, rbsA, and rbsC genes of Escherichia coli K12., J Biol Chem 261(17):7652-8

 [2] Lalaouna D., Morissette A., Carrier MC., Masse E., 2015, DsrA regulatory RNA represses both hns and rbsD mRNAs through distinct mechanisms in Escherichia coli., Mol Microbiol 98(2):357-69

 [3] Lease RA., Cusick ME., Belfort M., 1998, Riboregulation in Escherichia coli: DsrA RNA acts by RNA:RNA interactions at multiple loci., Proc Natl Acad Sci U S A 95(21):12456-61

 [4] Shimada T., Kori A., Ishihama A., 2013, Involvement of the ribose operon repressor RbsR in regulation of purine nucleotide synthesis in Escherichia coli., FEMS Microbiol Lett 344(2):159-65


RegulonDB