RegulonDB RegulonDB 10.8: Gene Form
   

rcsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliR rcsA dsrB RcsAB RcsAB rcsAp rcsAp

Gene      
Name: rcsA    Texpresso search in the literature
Synonym(s): ECK1949, EG10820, b1951, cpsR
Genome position(nucleotides): 2023968 --> 2024591 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.14
External database links:  
ASAP:
ABE-0006482
CGSC:
17980
ECHOBASE:
EB0813
OU-MICROARRAY:
b1951
PortEco:
rcsA
STRING:
511145.b1951
COLOMBOS: rcsA


Product      
Name: DNA-binding transcriptional activator RcsA
Synonym(s): CpsR, RcsA, positive DNA-binding transcriptional regulator of capsular polysaccharide synthesis, activates its own expression, positive regulator of capsular polysaccharide synthesis
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.516
Isoelectric point: 9.692
Motif(s):
 
Type Positions Sequence
137 -> 191 SLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHV
145 -> 145 M
131 -> 196 LNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTD
155 -> 174 TIQISDQMNIKAKTVSSHKG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.5 - K antigen
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0050896 - response to stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Da Re S., et al., 2013
[2] Gottesman S., et al., 1991
[3] Hersch SJ., et al., 2020
[4] Sledjeski DD., et al., 1996
[5] Stout V., et al., 1990
External database links:  
DIP:
DIP-48090N
ECOCYC:
PD02233
ECOLIWIKI:
b1951
INTERPRO:
IPR030866
INTERPRO:
IPR036388
INTERPRO:
IPR016032
INTERPRO:
IPR000792
MODBASE:
P69405
PFAM:
PF00196
PRIDE:
P0DMC9
PRINTS:
PR00038
PRODB:
PRO_000023689
PROSITE:
PS00622
PROSITE:
PS50043
REFSEQ:
NP_416461
SMART:
SM00421
SMR:
P0DMC9
UNIPROT:
P0DMC9


Operon      
Name: rcsA         
Operon arrangement:
Transcription unit        Promoter
rcsA


Transcriptional Regulation      
Display Regulation             
Activated by: RcsAB, GadE
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Da Re S., Valle J., Charbonnel N., Beloin C., Latour-Lambert P., Faure P., Turlin E., Le Bouguenec C., Renauld-Mongenie G., Forestier C., Ghigo JM., 2013, Identification of commensal Escherichia coli genes involved in biofilm resistance to pathogen colonization., PLoS One 8(5):e61628

 [2] Gottesman S., Stout V., 1991, Regulation of capsular polysaccharide synthesis in Escherichia coli K12., Mol Microbiol 5(7):1599-606

 [3] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol

 [4] Sledjeski DD., Gottesman S., 1996, Osmotic shock induction of capsule synthesis in Escherichia coli K-12., J Bacteriol 178(4):1204-6

 [5] Stout V., Gottesman S., 1990, RcsB and RcsC: a two-component regulator of capsule synthesis in Escherichia coli., J Bacteriol 172(2):659-69


RegulonDB