RegulonDB RegulonDB 10.6.3: Gene Form
   

rcsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliR rcsA dsrB RcsB RcsB rcsAp rcsAp

Gene      
Name: rcsA    Texpresso search in the literature
Synonym(s): ECK1949, EG10820, b1951, cpsR
Genome position(nucleotides): 2023968 --> 2024591 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.14
External database links:  
ASAP:
ABE-0006482
CGSC:
17980
ECHOBASE:
EB0813
ECOCYC:
EG10820
ECOLIHUB:
rcsA
OU-MICROARRAY:
b1951
REGULONDB:
b1951
STRING:
511145.b1951
M3D: rcsA
COLOMBOS: rcsA
PortEco: b1951


Product      
Name: DNA-binding transcriptional activator RcsA
Synonym(s): CpsR, RcsA, positive DNA-binding transcriptional regulator of capsular polysaccharide synthesis, activates its own expression, positive regulator of capsular polysaccharide synthesis
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.516
Isoelectric point: 9.692
Motif(s):
 
Type Positions Sequence
137 -> 191 SLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHV
145 -> 145 M
131 -> 196 LNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTD
155 -> 174 TIQISDQMNIKAKTVSSHKG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.5 - K antigen
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0050896 - response to stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Da Re S., et al., 2013
[2] Gottesman S., et al., 1991
[3] Sledjeski DD., et al., 1996
[4] Stout V., et al., 1990
External database links:  
DIP:
DIP-48090N
ECOCYC:
PD02233
ECOLIWIKI:
b1951
INTERPRO:
IPR036388
INTERPRO:
IPR030866
INTERPRO:
IPR000792
INTERPRO:
IPR016032
MODBASE:
P69405
PFAM:
PF00196
PRIDE:
P0DMC9
PRINTS:
PR00038
PRODB:
PRO_000023689
PROSITE:
PS00622
PROSITE:
PS50043
PROTEINMODELPORTAL:
P0DMC9
REFSEQ:
NP_416461
SMART:
SM00421
SMR:
P0DMC9
UNIPROT:
P0DMC9


Operon      
Name: rcsA         
Operon arrangement:
Transcription unit        Promoter
rcsA


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB, GadE
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Da Re S., Valle J., Charbonnel N., Beloin C., Latour-Lambert P., Faure P., Turlin E., Le Bouguenec C., Renauld-Mongenie G., Forestier C., Ghigo JM., 2013, Identification of commensal Escherichia coli genes involved in biofilm resistance to pathogen colonization., PLoS One 8(5):e61628

 [2] Gottesman S., Stout V., 1991, Regulation of capsular polysaccharide synthesis in Escherichia coli K12., Mol Microbiol 5(7):1599-606

 [3] Sledjeski DD., Gottesman S., 1996, Osmotic shock induction of capsule synthesis in Escherichia coli K-12., J Bacteriol 178(4):1204-6

 [4] Stout V., Gottesman S., 1990, RcsB and RcsC: a two-component regulator of capsule synthesis in Escherichia coli., J Bacteriol 172(2):659-69


RegulonDB