RegulonDB RegulonDB 10.8: Gene Form
   

rcsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcsC rcsD rcsB TSS_2500 TSS_2500 TSS_2499 TSS_2499 TSS_2498 TSS_2498 TSS_2497 TSS_2497 TSS_2496 TSS_2496 TSS_2495 TSS_2495 TSS_2494 (cluster) TSS_2494 (cluster) TSS_2493 TSS_2493 TSS_2492 TSS_2492 TSS_2491 TSS_2491 TSS_2490 (cluster) TSS_2490 (cluster) TSS_2489 (cluster) TSS_2489 (cluster) rcsBp2 rcsBp2 rcsBp1 rcsBp1

Gene      
Name: rcsB    Texpresso search in the literature
Synonym(s): ECK2210, EG10821, b2217
Genome position(nucleotides): 2316177 --> 2316827 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.77
External database links:  
ASAP:
ABE-0007333
CGSC:
17977
ECHOBASE:
EB0814
OU-MICROARRAY:
b2217
PortEco:
rcsB
STRING:
199310.c2760
COLOMBOS: rcsB


Product      
Name: DNA-binding transcriptional activator RcsB
Synonym(s): RcsB, RcsB response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 23.671
Isoelectric point: 7.761
Motif(s):
 
Type Positions Sequence
150 -> 204 RLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNY
6 -> 120 VIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKAL
168 -> 187 VTEIAKKLNRSIKTISSQKK
5 -> 124 NVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQ
144 -> 209 GGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
GO:0000160 - phosphorelay signal transduction system
GO:0044011 - single-species biofilm formation on inanimate substrate
GO:0031346 - positive regulation of cell projection organization
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Gottesman S., et al., 1991
[2] Hersch SJ., et al., 2020
[3] Pao GM., et al., 1995
[4] Parkinson JS. 1993
[5] Parkinson JS., et al., 1992
[6] Sledjeski DD., et al., 1996
[7] Stock JB., et al., 1990
[8] Stout V., et al., 1990
External database links:  
DIP:
DIP-31861N
ECOCYC:
RCSB-MONOMER
ECOLIWIKI:
b2217
INTERPRO:
IPR001789
INTERPRO:
IPR000792
INTERPRO:
IPR016032
INTERPRO:
IPR030864
INTERPRO:
IPR036388
INTERPRO:
IPR011006
MODBASE:
P69407
PDB:
5VXN
PDB:
5I4C
PDB:
5W43
PFAM:
PF00196
PFAM:
PF00072
PRIDE:
P0DMC7
PRINTS:
PR00038
PRODB:
PRO_000023690
PROSITE:
PS00622
PROSITE:
PS50110
PROSITE:
PS50043
REFSEQ:
NP_416721
SMART:
SM00421
SMART:
SM00448
SMR:
P0DMC7
SWISSMODEL:
P0DMC7
UNIPROT:
P0DMC7


Operon      
Name: rcsDB         
Operon arrangement:
Transcription unit        Promoter
rcsDB
rcsB
rcsB


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2489 (cluster) 2316062 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_2490 (cluster) 2316172 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_2491 2316181 forward nd [RS-EPT-CBR] [9]
  promoter TSS_2492 2316184 forward nd [RS-EPT-CBR] [9]
  promoter TSS_2493 2316190 forward nd [RS-EPT-CBR] [9]
  promoter TSS_2494 (cluster) 2316194 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_2495 2316231 forward nd [RS-EPT-CBR] [9]
  promoter TSS_2496 2316287 forward nd [RS-EPT-CBR] [9]
  promoter TSS_2497 2317398 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_2498 2317454 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_2499 2319113 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_2500 2319298 reverse nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gottesman S., Stout V., 1991, Regulation of capsular polysaccharide synthesis in Escherichia coli K12., Mol Microbiol 5(7):1599-606

 [2] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol

 [3] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [4] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [5] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [6] Sledjeski DD., Gottesman S., 1996, Osmotic shock induction of capsule synthesis in Escherichia coli K-12., J Bacteriol 178(4):1204-6

 [7] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [8] Stout V., Gottesman S., 1990, RcsB and RcsC: a two-component regulator of capsule synthesis in Escherichia coli., J Bacteriol 172(2):659-69

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB