RegulonDB RegulonDB 10.6.3: Gene Form
   

rcsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcsC rcsD rcsB TSS_2500 TSS_2500 TSS_2499 TSS_2499 TSS_2498 TSS_2498 TSS_2497 TSS_2497 TSS_2496 TSS_2496 TSS_2495 TSS_2495 TSS_2494 (cluster) TSS_2494 (cluster) TSS_2493 TSS_2493 TSS_2492 TSS_2492 TSS_2491 TSS_2491 TSS_2490 (cluster) TSS_2490 (cluster) TSS_2489 (cluster) TSS_2489 (cluster) rcsBp2 rcsBp2 rcsBp1 rcsBp1

Gene      
Name: rcsB    Texpresso search in the literature
Synonym(s): ECK2210, EG10821, b2217
Genome position(nucleotides): 2316177 --> 2316827 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.77
External database links:  
ASAP:
ABE-0007333
CGSC:
17977
ECHOBASE:
EB0814
ECOCYC:
EG10821
ECOLIHUB:
rcsB
OU-MICROARRAY:
b2217
REGULONDB:
b2217
STRING:
199310.c2760
M3D: rcsB
COLOMBOS: rcsB
PortEco: b2217


Product      
Name: DNA-binding transcriptional activator RcsB
Synonym(s): RcsB, RcsB response regulator
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.671
Isoelectric point: 7.761
Motif(s):
 
Type Positions Sequence
150 -> 204 RLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNY
6 -> 120 VIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKAL
168 -> 187 VTEIAKKLNRSIKTISSQKK
5 -> 124 NVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQ
144 -> 209 GGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
GO:0000160 - phosphorelay signal transduction system
GO:0044011 - single-species biofilm formation on inanimate substrate
GO:0031346 - positive regulation of cell projection organization
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Gottesman S., et al., 1991
[2] Pao GM., et al., 1995
[3] Parkinson JS. 1993
[4] Parkinson JS., et al., 1992
[5] Sledjeski DD., et al., 1996
[6] Stock JB., et al., 1990
[7] Stout V., et al., 1990
External database links:  
DIP:
DIP-31861N
ECOCYC:
RCSB-MONOMER
ECOLIWIKI:
b2217
INTERPRO:
IPR036388
INTERPRO:
IPR030864
INTERPRO:
IPR016032
INTERPRO:
IPR011006
INTERPRO:
IPR001789
INTERPRO:
IPR000792
MODBASE:
P69407
PDB:
5W43
PDB:
5VXN
PDB:
5I4C
PFAM:
PF00072
PFAM:
PF00196
PRIDE:
P0DMC7
PRINTS:
PR00038
PRODB:
PRO_000023690
PROSITE:
PS50043
PROSITE:
PS50110
PROSITE:
PS00622
PROTEINMODELPORTAL:
P0DMC7
REFSEQ:
NP_416721
SMART:
SM00448
SMART:
SM00421
SMR:
P0DMC7
SWISSMODEL:
P0DMC7
UNIPROT:
P0DMC7


Operon      
Name: rcsDB         
Operon arrangement:
Transcription unit        Promoter
rcsDB
rcsB
rcsB


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2489 (cluster) 2316062 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_2490 (cluster) 2316172 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_2491 2316181 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2492 2316184 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2493 2316190 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2494 (cluster) 2316194 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_2495 2316231 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2496 2316287 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2497 2317398 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2498 2317454 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2499 2319113 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2500 2319298 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gottesman S., Stout V., 1991, Regulation of capsular polysaccharide synthesis in Escherichia coli K12., Mol Microbiol 5(7):1599-606

 [2] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [3] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [4] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [5] Sledjeski DD., Gottesman S., 1996, Osmotic shock induction of capsule synthesis in Escherichia coli K-12., J Bacteriol 178(4):1204-6

 [6] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [7] Stout V., Gottesman S., 1990, RcsB and RcsC: a two-component regulator of capsule synthesis in Escherichia coli., J Bacteriol 172(2):659-69

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB