RegulonDB RegulonDB 10.8: Gene Form
   

recG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recG gltS trmH TSS_4243 TSS_4243 TSS_4242 TSS_4242 TSS_4241 TSS_4241

Gene      
Name: recG    Texpresso search in the literature
Synonym(s): ECK3642, EG10829, b3652, radC, spoV
Genome position(nucleotides): 3825210 --> 3827291 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.2
External database links:  
ASAP:
ABE-0011939
CGSC:
307
ECHOBASE:
EB0822
OU-MICROARRAY:
b3652
PortEco:
recG
STRING:
511145.b3652
COLOMBOS: recG


Product      
Name: ATP-dependent DNA helicase RecG
Synonym(s): RadC, RecG, SpoV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 76.43
Isoelectric point: 7.263
Motif(s):
 
Type Positions Sequence
15 -> 171 TGVGAALSNKLAKINLHTVQDLLLHLPLRYEDRTHLYPIGELLPGVYATVEGEVLNCNISFGGRRMMTCQISDGSGILTMRFFNFSAAMKNSLAAGRRVLAYGEAKRGKYGAEMIHPEYRVQGDLSTPELQETLTPVYPTTEGVKQATLRKLTDQAL
397 -> 400 DEQH
481 -> 588 TEGRQAYWVCTLIEESELLEAQAAEATWEELKLALPELNVGLVHGRMKPAEKQAVMASFKQGELHLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRG
273 -> 433 QARVVAEIERDMALDVPMMRLVQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRNWFAPLGIEVGWLAGKQKGKARLAQQEAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQHRFGVHQRLALWEKGQQQGFHPHQLIMTATPIPR
482 -> 628 EGRQAYWVCTLIEESELLEAQAAEATWEELKLALPELNVGLVHGRMKPAEKQAVMASFKQGELHLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKTPLSKTAQIRLQVLRDSNDGFVIAQKDLE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009379 - Holliday junction helicase complex
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009314 - response to radiation
GO:0032508 - DNA duplex unwinding
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Lloyd RG., et al., 1993
[2] Wardrope L., et al., 2009
[3] Wendel BM., et al., 2014
[4] Whitby MC., et al., 1994
External database links:  
DIP:
DIP-10653N
ECOCYC:
EG10829-MONOMER
ECOLIWIKI:
b3652
INTERPRO:
IPR011545
INTERPRO:
IPR033454
INTERPRO:
IPR027417
INTERPRO:
IPR014001
INTERPRO:
IPR012340
INTERPRO:
IPR004609
INTERPRO:
IPR001650
MINT:
MINT-1301344
MODBASE:
P24230
PFAM:
PF00270
PFAM:
PF00271
PFAM:
PF17191
PRIDE:
P24230
PRODB:
PRO_000023702
PROSITE:
PS51194
PROSITE:
PS51192
REFSEQ:
NP_418109
SMART:
SM00487
SMART:
SM00490
SMR:
P24230
UNIPROT:
P24230


Operon      
Name: rpoZ-spoT-trmH-recG         
Operon arrangement:
Transcription unit        Promoter
rpoZ-spoT-trmH-recG
recG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4241 3824657 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4242 3826330 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4243 3826678 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lloyd RG., Sharples GJ., 1993, Dissociation of synthetic Holliday junctions by E. coli RecG protein., EMBO J 12(1):17-22

 [2] Wardrope L., Okely E., Leach D., 2009, Resolution of joint molecules by RuvABC and RecG following cleavage of the Escherichia coli chromosome by EcoKI., PLoS One 4(8):e6542

 [3] Wendel BM., Courcelle CT., Courcelle J., 2014, Completion of DNA replication in Escherichia coli., Proc Natl Acad Sci U S A 111(46):16454-9

 [4] Whitby MC., Vincent SD., Lloyd RG., 1994, Branch migration of Holliday junctions: identification of RecG protein as a junction specific DNA helicase., EMBO J 13(21):5220-8

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB