RegulonDB RegulonDB 10.8: Gene Form
   

recQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recQ pldA rhtC LexA terminator rhtCp2 rhtCp2 TSS_4480 TSS_4480 recQp1 recQp1 recQp recQp recQp2 recQp2

Gene      
Name: recQ    Texpresso search in the literature
Synonym(s): ECK3816, EG10833, b3822
Genome position(nucleotides): 4005864 --> 4007693 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.14
External database links:  
ASAP:
ABE-0012483
CGSC:
17959
ECHOBASE:
EB0826
OU-MICROARRAY:
b3822
PortEco:
recQ
STRING:
511145.b3822
COLOMBOS: recQ


Product      
Name: ATP-dependent DNA helicase RecQ
Synonym(s): RecQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,bacterial nucleoid
Molecular weight: 68.363
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
533 -> 599 RKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALI
47 -> 54 MPTGGGKS
222 -> 330 KPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRD
2 -> 609 AQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGSTDAQIALSTIGRVNQRFGMGYVVEVIRGANNQRIRDYGHDKLKVYGMGRDKSHEHWVSVIRQLIHLGLVTQNIAQHSALQLTEAARPVLRGESSLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIRAHVDGDDEE
146 -> 149 DEAH

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005694 - chromosome
GO:0030894 - replisome
GO:0017117 - single-stranded DNA-dependent ATP-dependent DNA helicase complex
GO:0043590 - bacterial nucleoid
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0003824 - catalytic activity
GO:0046914 - transition metal ion binding
GO:0005515 - protein binding
GO:0008094 - DNA-dependent ATPase activity
GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0043138 - 3'-5' DNA helicase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
GO:0009378 - four-way junction helicase activity
GO:0017116 - single-stranded DNA helicase activity
biological_process GO:0044237 - cellular metabolic process
GO:0006260 - DNA replication
GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
GO:0032508 - DNA duplex unwinding
Note(s): Note(s): ...[more].
Reference(s): [1] Irino N., et al., 1986
[2] Morimatsu K., et al., 2014
External database links:  
DIP:
DIP-10656N
ECOCYC:
EG10833-MONOMER
ECOLIWIKI:
b3822
INTERPRO:
IPR006293
INTERPRO:
IPR036388
INTERPRO:
IPR032284
INTERPRO:
IPR027417
INTERPRO:
IPR018982
INTERPRO:
IPR014001
INTERPRO:
IPR011545
INTERPRO:
IPR010997
INTERPRO:
IPR004589
INTERPRO:
IPR002121
INTERPRO:
IPR001650
MINT:
MINT-1223947
MODBASE:
P15043
PDB:
1OYY
PDB:
1OYW
PDB:
1WUD
PFAM:
PF16124
PFAM:
PF00570
PFAM:
PF00271
PFAM:
PF09382
PFAM:
PF00270
PRIDE:
P15043
PRODB:
PRO_000023706
PROSITE:
PS50967
PROSITE:
PS51194
PROSITE:
PS51192
REFSEQ:
YP_026263
SMART:
SM00956
SMART:
SM00490
SMART:
SM00487
SMART:
SM00341
SMR:
P15043
UNIPROT:
P15043


Operon      
Name: recQ         
Operon arrangement:
Transcription unit        Promoter
recQ


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter recQp2 4005833 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter recQp1 4005858 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4480 4007726 forward nd [RS-EPT-CBR] [4]
  promoter rhtCp2 4007739 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Irino N., Nakayama K., Nakayama H., 1986, The recQ gene of Escherichia coli K12: primary structure and evidence for SOS regulation., Mol Gen Genet 205(2):298-304

 [2] Morimatsu K., Kowalczykowski SC., 2014, RecQ helicase and RecJ nuclease provide complementary functions to resect DNA for homologous recombination., Proc Natl Acad Sci U S A 111(48):E5133-42

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB