RegulonDB RegulonDB 10.7: Gene Form
   

relA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

relA rlmD mazE CRP HipB HipAB Fis MazE-MazF MazE MazE MazE-MazF ppGpp ppGpp relAp4 relAp4 relAp2 relAp2 relAp1 relAp1 relAp3 relAp3 TSS_3086 TSS_3086 TSS_3085 TSS_3085 mazEp1 mazEp1 mazEp2 mazEp2

Gene      
Name: relA    Texpresso search in the literature
Synonym(s): ECK2778, EG10835, RC, b2784
Genome position(nucleotides): 2911417 <-- 2913651 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.78
External database links:  
ASAP:
ABE-0009125
CGSC:
306
ECHOBASE:
EB0828
OU-MICROARRAY:
b2784
PORTECO:
relA
REGULONDB:
b2784
STRING:
511145.b2784
M3D: relA
COLOMBOS: relA
PortEco: b2784


Product      
Name: GDP/GTP pyrophosphokinase
Synonym(s): (p)ppGpp synthetase I, PSI, RelA, ppGpp synthase I, ppGpp synthetase I, stringent factor
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 83.876
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
55 -> 160 LLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQLKATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHL
307 -> 307 F
44 -> 191 QQTQGHPDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQLKATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREVKDAPEDERVLAAKECTNIYAPLANRLGI
406 -> 465 VYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIIT
404 -> 465 DRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIIT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005525 - GTP binding
GO:0008728 - GTP diphosphokinase activity
GO:0008893 - guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity
biological_process GO:0015949 - nucleobase-containing small molecule interconversion
GO:0042594 - response to starvation
GO:0016310 - phosphorylation
GO:0015969 - guanosine tetraphosphate metabolic process
GO:0015970 - guanosine tetraphosphate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Brown A., et al., 2016
External database links:  
DIP:
DIP-10658N
ECOCYC:
RELA-MONOMER
ECOLIWIKI:
b2784
INTERPRO:
IPR007685
INTERPRO:
IPR004811
INTERPRO:
IPR002912
INTERPRO:
IPR012676
INTERPRO:
IPR012675
INTERPRO:
IPR003607
INTERPRO:
IPR004095
INTERPRO:
IPR033655
MODBASE:
P0AG20
PANTHER:
PTHR21262:SF1
PANTHER:
PTHR21262
PDB:
5L3P
PDB:
5KPX
PDB:
5KPW
PDB:
5KPV
PDB:
5KPS
PDB:
5IQR
PFAM:
PF04607
PFAM:
PF13328
PFAM:
PF13291
PFAM:
PF02824
PRIDE:
P0AG20
PRODB:
PRO_000023710
PROSITE:
PS51831
PROSITE:
PS51671
PROSITE:
PS51880
PROTEINMODELPORTAL:
P0AG20
REFSEQ:
NP_417264
SMART:
SM00954
SMR:
P0AG20
UNIPROT:
P0AG20


Operon      
Name: relA-mazEFG         
Operon arrangement:
Transcription unit        Promoter
mazEFG
mazEFG
relA
relA-mazEF
relA-mazEF
relA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, NtrC
Repressed by: HipAB, HipB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3085 2913146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3086 2913158 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Brown A., Fernandez IS., Gordiyenko Y., Ramakrishnan V., 2016, Ribosome-dependent activation of stringent control., Nature 534(7606):277-80

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB