RegulonDB RegulonDB 10.8: Gene Form
   

fliD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliC fliD fliS FlhDC FlhDC TSS_2265 TSS_2265 fliDp fliDp fliCp fliCp TSS_2264 TSS_2264 TSS_2263 TSS_2263 TSS_2262 TSS_2262 TSS_2261 TSS_2261

Gene      
Name: fliD    Texpresso search in the literature
Synonym(s): ECK1923, EG10841, b1924, flbC, rfs
Genome position(nucleotides): 2003872 --> 2005278 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.24
External database links:  
ASAP:
ABE-0006407
CGSC:
748
ECHOBASE:
EB0834
OU-MICROARRAY:
b1924
PortEco:
fliD
STRING:
511145.b1924
COLOMBOS: fliD


Shine dalgarno      
Sequence: cgaaagataaAAGGAAatcgcATG


Product      
Name: flagellar filament capping protein
Synonym(s): FlbC, FliD, HAP2, Rfs, hook-associated protein 2
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,cell projection
Molecular weight: 48.456
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
222 -> 452 AQNAQLTVNNVAIENSSNTISDALENITLNLNDVTTGNQTLTITQDTSKAQTAIKDWVNAYNSLIDTFSSLTKYTAVDAGADSQSSSNGALLGDSTLRTIQTQLKSMLSNTVSSSSYKTLAQIGITTDPSDGKLELDADKLTAALKKDASGVGALIVGDGKKTGITTTIGSNLTSWLSTTGIIKAATDGVSKTLNKLTKDYNAASDRIDAQVARYKEQFTQLDVLMTSLNS
2 -> 468 ASISSLGVGSGLDLSSILDSLTAAQKATLTPISNQQSSFTAKLSAYGTLKSALTTFQTANTALSKADLFSATSTTSSTTAFSATTAGNAIAGKYTISVTHLAQAQTLTTRTTRDDTKTAIATSDSKLTIQQGGDKDPITIDISAANSSLSGIRDAINNAKAGVSASIINVGNGEYRLSVTSNDTGLDNAMTLSVSGDDALQSFMGYDASASSNGMEVSVAAQNAQLTVNNVAIENSSNTISDALENITLNLNDVTTGNQTLTITQDTSKAQTAIKDWVNAYNSLIDTFSSLTKYTAVDAGADSQSSSNGALLGDSTLRTIQTQLKSMLSNTVSSSSYKTLAQIGITTDPSDGKLELDADKLTAALKKDASGVGALIVGDGKKTGITTTIGSNLTSWLSTTGIIKAATDGVSKTLNKLTKDYNAASDRIDAQVARYKEQFTQLDVLMTSLNSTSSYLTQQFENNSNSK
11 -> 106 SGLDLSSILDSLTAAQKATLTPISNQQSSFTAKLSAYGTLKSALTTFQTANTALSKADLFSATSTTSSTTAFSATTAGNAIAGKYTISVTHLAQAQ
114 -> 114 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009421 - bacterial-type flagellum filament cap
molecular_function GO:0005515 - protein binding
biological_process GO:0007155 - cell adhesion
GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Juhas M., et al., 2014
[2] Song WS., et al., 2017
External database links:  
ECOCYC:
EG10841-MONOMER
ECOLIWIKI:
b1924
INTERPRO:
IPR003481
INTERPRO:
IPR040026
INTERPRO:
IPR010809
PANTHER:
PTHR30288
PDB:
5H5W
PDB:
5H5V
PFAM:
PF02465
PFAM:
PF07195
PRIDE:
P24216
PRODB:
PRO_000022656
REFSEQ:
NP_416434
SMR:
P24216
UNIPROT:
P24216


Operon      
Name: fliDST         
Operon arrangement:
Transcription unit        Promoter
fliDST
fliDST


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2261 2002392 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2262 2002401 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2263 2003300 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2264 2003675 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2265 2003836 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Juhas M., Evans LD., Frost J., Davenport PW., Yarkoni O., Fraser GM., Ajioka JW., 2014, Escherichia coli flagellar genes as target sites for integration and expression of genetic circuits., PLoS One 9(10):e111451

 [2] Song WS., Cho SY., Hong HJ., Park SC., Yoon SI., 2017, Self-Oligomerizing Structure of the Flagellar Cap Protein FliD and Its Implication in Filament Assembly., J Mol Biol 429(6):847-857

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB