RegulonDB RegulonDB 10.9: Gene Form
   

rhaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhaT rhaR rhaS sodA RhaS SoxR IHF ArcA ArcA ArcA ArcA IHF Fur Fur ArcA FNR Fur ArcA Rob MarA Fur SoxS IHF IHF CRP RhaS RhaS RhaS terminator sodAp sodAp rhaTp rhaTp

Gene      
Name: rhaR    Texpresso search in the literature
Synonym(s): ECK3899, EG10842, b3906, rhaC1
Genome position(nucleotides): 4098646 --> 4099494 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.18
External database links:  
ASAP:
ABE-0012747
CGSC:
290
ECHOBASE:
EB0835
ECOLIHUB:
rhaR
OU-MICROARRAY:
b3906
STRING:
511145.b3906
COLOMBOS: rhaR


Shine dalgarno      
Sequence: tctggccgagGTAGCCacgGTG


Product      
Name: DNA-binding transcriptional activator RhaR
Synonym(s): RhaR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 32.373
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
244 -> 267 ISDISTECGFEDSNYFSVVFTRET
179 -> 277 DKLITRLAASLKSPFALDKFCDEASCSERVLRQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTECGFEDSNYFSVVFTRETGMTPSQWRHL
23 -> 140 ADRYPQDVFAEHTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASVNDLVLQNIIYCPERLKLNLDWQGAIPGFNASAGQPHWRLGSMGMAQARQVIGQLEHESSQH
196 -> 217 DKFCDEASCSERVLRQQFRQQT
199 -> 275 CDEASCSERVLRQQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTECGFEDSNYFSVVFTRETGMTPSQWR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0019299 - rhamnose metabolic process
GO:0045893 - positive regulation of transcription, DNA-templated
Reference(s): [1] Egan SM., et al., 1993
[2] Garcia-Martin C., et al., 1992
[3] Plunkett G., et al., 1993
[4] Tate CG., et al., 1992
[5] Tobin JF., et al., 1987
External database links:  
DIP:
DIP-10693N
ECOCYC:
PD00222
ECOLIWIKI:
b3906
INTERPRO:
IPR014710
INTERPRO:
IPR023699
INTERPRO:
IPR020449
INTERPRO:
IPR018062
INTERPRO:
IPR018060
INTERPRO:
IPR011051
INTERPRO:
IPR009057
INTERPRO:
IPR003313
MODBASE:
P09378
PFAM:
PF02311
PFAM:
PF12833
PRIDE:
P09378
PRINTS:
PR00032
PRODB:
PRO_000023737
PROSITE:
PS01124
PROSITE:
PS00041
REFSEQ:
NP_418342
SMART:
SM00342
SMR:
P09378
UNIPROT:
P09378


Operon      
Name: rhaSR         
Operon arrangement:
Transcription unit        Promoter
rhaSR
rhaSR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, RhaR, RhaS
Undetermined regulation RhaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Egan SM., Schleif RF., 1993, A regulatory cascade in the induction of rhaBAD., J Mol Biol 234(1):87-98

 [2] Garcia-Martin C., Baldoma L., Badia J., Aguilar J., 1992, Nucleotide sequence of the rhaR-sodA interval specifying rhaT in Escherichia coli., J Gen Microbiol 138(6):1109-16

 [3] Plunkett G., Burland V., Daniels DL., Blattner FR., 1993, Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes., Nucleic Acids Res 21(15):3391-8

 [4] Tate CG., Muiry JA., Henderson PJ., 1992, Mapping, cloning, expression, and sequencing of the rhaT gene, which encodes a novel L-rhamnose-H+ transport protein in Salmonella typhimurium and Escherichia coli., J Biol Chem 267(10):6923-32

 [5] Tobin JF., Schleif RF., 1987, Positive regulation of the Escherichia coli L-rhamnose operon is mediated by the products of tandemly repeated regulatory genes., J Mol Biol 196(4):789-99


RegulonDB