RegulonDB RegulonDB 10.7: Gene Form
   

rimK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rimK nfsA ybjN ybjC TSS_1000 TSS_1000 rimKp rimKp

Gene      
Name: rimK    Texpresso search in the literature
Synonym(s): ECK0843, EG10852, b0852, nek
Genome position(nucleotides): 891967 --> 892869 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.26
External database links:  
ASAP:
ABE-0002903
CGSC:
31682
ECHOBASE:
EB0845
OU-MICROARRAY:
b0852
PORTECO:
rimK
REGULONDB:
b0852
STRING:
511145.b0852
M3D: rimK
COLOMBOS: rimK
PortEco: b0852


Product      
Name: ribosomal protein S6 modification protein
Synonym(s): Nek, RimK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.436
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
1 -> 18 MKIAILSRDGTLYSCKRL
211 -> 213 RSN
104 -> 287 MQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIE
178 -> 179 EY
97 -> 286 ARDKLRSMQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYIKEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTMALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0018169 - ribosomal S6-glutamic acid ligase activity
biological_process GO:0006412 - translation
GO:0006464 - cellular protein modification process
GO:0009432 - SOS response
GO:0018410 - C-terminal protein amino acid modification
External database links:  
ECOCYC:
EG10852-MONOMER
ECOLIWIKI:
b0852
INTERPRO:
IPR013815
INTERPRO:
IPR013651
INTERPRO:
IPR011761
INTERPRO:
IPR041107
INTERPRO:
IPR004666
INTERPRO:
IPR023533
MODBASE:
P0C0U4
PDB:
5ZK6
PDB:
5ZCT
PDB:
4IWY
PDB:
4IWX
PFAM:
PF08443
PFAM:
PF18030
PRIDE:
P0C0U4
PRODB:
PRO_000023760
PROSITE:
PS50975
PROTEINMODELPORTAL:
P0C0U4
REFSEQ:
NP_415373
SMR:
P0C0U4
UNIPROT:
P0C0U4


Operon      
Name: ybjC-nfsA-rimK-ybjN         
Operon arrangement:
Transcription unit        Promoter
ybjC-nfsA-rimK-ybjN
rimK-ybjN
ybjN


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, Rob, SoxS
Repressed by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1000 892926 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB