RegulonDB RegulonDB 10.8: Gene Form
   

rimL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tehA ydcK rimL ydcH tehB NsrR NsrR terminator anti-terminator anti-anti-terminator terminator TSS_1811 TSS_1811 TSS_1810 TSS_1810 TSS_1809 TSS_1809 ydcKp8 ydcKp8 tehAp tehAp rimLp rimLp

Gene      
Name: rimL    Texpresso search in the literature
Synonym(s): ECK1420, EG10853, b1427
Genome position(nucleotides): 1498938 --> 1499477 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.33
External database links:  
ASAP:
ABE-0004763
CGSC:
275
ECHOBASE:
EB0846
ECOO157CYC:
Z2291
OU-MICROARRAY:
b1427
PortEco:
rimL
STRING:
511145.b1427
COLOMBOS: rimL


Product      
Name: ribosomal-protein-L12-serine N-acetyltransferase
Synonym(s): RimL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.681
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
11 -> 150 LELHAVAENHVKPLYQLICKNKTWLQQSLNWPQFVQSEEDTRKTVQGNVMLHQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGYWLDESHQGQGIISQALQALIHHYAQSGELRRFVIKCRVDNPQSNQVALRNGF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004596 - peptide alpha-N-acetyltransferase activity
GO:0008999 - ribosomal-protein-alanine N-acetyltransferase activity
GO:1990189 - peptide-serine-N-acetyltransferase activity
biological_process GO:0006464 - cellular protein modification process
GO:0006474 - N-terminal protein amino acid acetylation
GO:0017198 - N-terminal peptidyl-serine acetylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10853-MONOMER
ECOLIWIKI:
b1427
ECOO157CYC:
Z2291-MONOMER
INTERPRO:
IPR016181
INTERPRO:
IPR000182
MODBASE:
P13857
PFAM:
PF13302
PRIDE:
P13857
PRODB:
PRO_000023761
PROSITE:
PS51186
REFSEQ:
NP_415944
SMR:
P13857
SWISSMODEL:
P13857
UNIPROT:
P13857


Operon      
Name: rimL         
Operon arrangement:
Transcription unit        Promoter
rimL


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydcKp8 1500640 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1809 1501349 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1810 1501486 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1811 1501538 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB