RegulonDB RegulonDB 10.8: Gene Form
   

rnd gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadD rnd yeaX sroD anti-anti-terminator anti-terminator terminator rndp rndp

Gene      
Name: rnd    Texpresso search in the literature
Synonym(s): ECK1802, EG10858, b1804
Genome position(nucleotides): 1886864 <-- 1887991 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.08
Reference(s): [1] Zaniewski R., et al., 1982
[2] Zhang JR., et al., 1988
External database links:  
ASAP:
ABE-0006003
CGSC:
270
ECHOBASE:
EB0851
OU-MICROARRAY:
b1804
PortEco:
rnd
STRING:
511145.b1804
COLOMBOS: rnd


Product      
Name: RNase D
Synonym(s): Rnd, ribonuclease D
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.734
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
213 -> 279 QLACLQLLADWRLRKARERDLAVNFVVREEHLWSVARYMPGSLGELDSLGLSGSEIRFHGKTLLALV
3 -> 169 YQMITTDDALASLCEAVRAFPAIALDTEFVRTRTYYPQLGLIQLFDGEHLALIDPLGITDWSPLKAILRDPSITKFLHAGSEDLEVFLNVFGELPQPLIDTQILAAFCGRPMSWGFASMVEEYSGVTLDKSESRTDWLARPLTERQCEYAAADVWYLLPITAKLMVE
210 -> 289 RTRQLACLQLLADWRLRKARERDLAVNFVVREEHLWSVARYMPGSLGELDSLGLSGSEIRFHGKTLLALVEKAQTLPEDA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.1 - RNA
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003824 - catalytic activity
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0016787 - hydrolase activity
GO:0008408 - 3'-5' exonuclease activity
GO:0000175 - 3'-5'-exoribonuclease activity
GO:0000166 - nucleotide binding
GO:0033890 - ribonuclease D activity
biological_process GO:0044237 - cellular metabolic process
GO:0006139 - nucleobase-containing compound metabolic process
GO:0008033 - tRNA processing
GO:0042780 - tRNA 3'-end processing
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090503 - RNA phosphodiester bond hydrolysis, exonucleolytic
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10726N
ECOCYC:
EG10858-MONOMER
ECOLIWIKI:
b1804
INTERPRO:
IPR036397
INTERPRO:
IPR010997
INTERPRO:
IPR006292
INTERPRO:
IPR002121
INTERPRO:
IPR012337
INTERPRO:
IPR002562
MINT:
MINT-1309170
MODBASE:
P09155
PDB:
1YT3
PFAM:
PF01612
PFAM:
PF00570
PRIDE:
P09155
PRODB:
PRO_000023788
PROSITE:
PS50967
REFSEQ:
NP_416318
SMART:
SM00474
SMART:
SM00341
SMR:
P09155
UNIPROT:
P09155


Operon      
Name: rnd         
Operon arrangement:
Transcription unit        Promoter
rnd


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Zaniewski R., Deutscher MP., 1982, Genetic mapping of mutation in Escherichia coli leading to a temperature-sensitive RNase D., Mol Gen Genet 185(1):142-7

 [2] Zhang JR., Deutscher MP., 1988, Escherichia coli RNase D: sequencing of the rnd structural gene and purification of the overexpressed protein., Nucleic Acids Res 16(14A):6265-78


RegulonDB