RegulonDB RegulonDB 10.9: Gene Form
   

rplQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpoA rplQ yhdN TSS_3624 (cluster) TSS_3624 (cluster) TSS_3623 TSS_3623 TSS_3622 (cluster) TSS_3622 (cluster) TSS_3621 TSS_3621 TSS_3620 TSS_3620 TSS_3619 TSS_3619 TSS_3618 TSS_3618 TSS_3617 TSS_3617 TSS_3616 TSS_3616 TSS_3615 TSS_3615 TSS_3614 TSS_3614 TSS_3613 TSS_3613 TSS_3612 TSS_3612 TSS_3611 TSS_3611 yhdNp yhdNp zntRp2 zntRp2

Gene      
Name: rplQ    Texpresso search in the literature
Synonym(s): ECK3281, EG10878, b3294
Genome position(nucleotides): 3439616 <-- 3439999 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.65
External database links:  
ASAP:
ABE-0010799
CGSC:
249
ECHOBASE:
EB0871
ECOLIHUB:
rplQ
OU-MICROARRAY:
b3294
STRING:
511145.b3294
COLOMBOS: rplQ


Product      
Name: 50S ribosomal subunit protein L17
Synonym(s): RplQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 14.365
Isoelectric point: 11.623
Motif(s):
 
Type Positions Sequence
20 -> 116 MFRNMAGSLVRHEIIKTTLPKAKELRRVVEPLITLAKTDSVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRAGDNAPMAYIELV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015934 - large ribosomal subunit
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
biological_process GO:0006412 - translation
GO:0000027 - ribosomal large subunit assembly
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35801N
ECOCYC:
EG10878-MONOMER
ECOLIWIKI:
b3294
INTERPRO:
IPR000456
INTERPRO:
IPR036373
MODBASE:
P0AG44
PANTHER:
PTHR14413
PDB:
2J28
PDB:
2RDO
PDB:
3BBX
PDB:
3J5L
PDB:
3J7Z
PDB:
3J8G
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
4CSU
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4UY8
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5ADY
PDB:
5AFI
PDB:
5AKA
PDB:
5GAD
PDB:
5GAE
PDB:
5GAF
PDB:
5GAG
PDB:
5GAH
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5MGP
PDB:
5NCO
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GBZ
PDB:
6GC0
PDB:
6GC4
PDB:
6GC6
PDB:
6GC7
PDB:
6GC8
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I0Y
PDB:
6I7V
PDB:
6O9J
PDB:
6O9K
PDB:
6OFX
PDB:
6OG7
PDB:
6ORE
PDB:
6ORL
PDB:
6OST
PDB:
6OT3
PDB:
6OUO
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6QUL
PDB:
6S0K
PDB:
6SZS
PDB:
6TBV
PDB:
6TC3
PFAM:
PF01196
PRIDE:
P0AG44
PRODB:
PRO_000023823
PROSITE:
PS01167
REFSEQ:
NP_417753
SMR:
P0AG44
SWISSMODEL:
P0AG44
UNIPROT:
P0AG44


Operon      
Name: rpsMKD-rpoA-rplQ         
Operon arrangement:
Transcription unit        Promoter
rpsMKD-rpoA-rplQ
rpsMKD-rpoA-rplQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter zntRp2 3439168 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3611 3439845 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3612 3439858 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3613 3439992 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3614 3439994 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3615 3440198 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3616 3440200 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3617 3440202 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3618 3440207 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3619 3440256 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3620 3440528 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3621 3440670 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3622 (cluster) 3440696 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3623 3440698 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3624 (cluster) 3441009 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB