RegulonDB RegulonDB 11.0: Gene Form

rpmF gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

plsX yceD rpmF FadR DksA-ppGpp DksA-ppGpp fabHp fabHp TSS_1388 TSS_1388 TSS_1387 TSS_1387 plsXp plsXp TSS_1386 (cluster) TSS_1386 (cluster) TSS_1385 TSS_1385 rpmFp rpmFp TSS_1384 (cluster) TSS_1384 (cluster) TSS_1383 TSS_1383 TSS_1382 (cluster) TSS_1382 (cluster) TSS_1381 TSS_1381 TSS_1380 TSS_1380 TSS_1379 (cluster) TSS_1379 (cluster) TSS_1378 TSS_1378 TSS_1377 TSS_1377 TSS_1376 (cluster) TSS_1376 (cluster) TSS_1375 (cluster) TSS_1375 (cluster) TSS_1374 TSS_1374 TSS_1373 TSS_1373 TSS_1372 TSS_1372 TSS_1371 TSS_1371 TSS_1370 TSS_1370

Name: rpmF    Texpresso search in the literature
Synonym(s): ECK1075, EG10890, b1089
Genome position(nucleotides): 1147367 --> 1147540
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: 50S ribosomal subunit protein L32
Synonym(s): RpmF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 6.446
Isoelectric point: 11.623
Type Positions Sequence Comment
1 -> 38 MAVQQNKPTRSKRGMRRSHDALTAVTSLSVDKTSGEKH UniProt: Disordered; Sequence Annotation Type: region of interest.


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015934 - large ribosomal subunit
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
biological_process GO:0006412 - translation
GO:0000027 - ribosomal large subunit assembly
GO:0000302 - response to reactive oxygen species
GO:0009314 - response to radiation
GO:0002181 - cytoplasmic translation
Note(s): Note(s): ...[more].
Reference(s): [1] Andrieux E., et al., 1984
[2] Barritault D., et al., 1975
[3] Bausk EV., et al., 1985
[4] Dzionara M., et al., 1977
[5] Gimautdinova OI., et al., 1981
[6] Gimautdinova OI., et al., 1982
[7] Gimautdinova OI., et al., 1984
[8] Graifer DM., et al., 1989
[9] Isono S., et al., 1978
[10] Janda I., et al., 1985
[11] Laughrea M., et al., 1987
[12] Mustoe AM., et al., 2018
[13] Oh W., et al., 1992
[14] Pichon JL., et al., 1977
[15] Podkovyrov S., et al., 1995
[16] Tanaka Y., et al., 1989
[17] Tejedor F., et al., 1985
[18] Wittmann-Liebold B., et al., 1975
[19] Zhang Y., et al., 1998
External database links:  

Name: yceD-rpmF-plsX-fabHDG-acpP-fabF         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1370 1146794 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1371 1146809 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1372 1147056 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1373 1147094 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1374 1147132 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1375 (cluster) 1147141 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1376 (cluster) 1147146 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1377 1147188 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1378 1147194 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1379 (cluster) 1147206 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1380 1147213 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1381 1147215 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1382 (cluster) 1147300 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1383 1147307 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1384 (cluster) 1147313 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1385 1147350 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1386 (cluster) 1147395 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1387 1147771 forward nd [RS-EPT-CBR] [20]
  promoter TSS_1388 1148362 forward nd [RS-EPT-CBR] [20]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Andrieux E., Cozzone AJ., 1984, Conformational changes in bacterial polysomes induced by amino acid starvation., Int J Biochem 16(1):113-6

 [2] Barritault D., Expert-Bezancon A., Milet M., 1975, [Nearest-neighbor relationships among 50S ribosomal proteins of E. coli]., C R Acad Sci Hebd Seances Acad Sci D 281(14):1043-6

 [3] Bausk EV., Graifer DM., Karpova GG., 1985, [Study of the photoaffinity modification of Escherichia coli ribosomes near the donor tRNA-binding center]., Mol Biol (Mosk) 19(2):545-52

 [4] Dzionara M., Robinson SM., Wittmann-Liebold B., 1977, Prediction for secondary structures of ten proteins from the 50S subunit of the Escherichia coli ribosome., J Supramol Struct 7(2):191-204

 [5] Gimautdinova OI., Karpova GG., Knorre DG., Kobetz ND., 1981, The proteins of the messenger RNA binding site of Escherichia coli ribosomes., Nucleic Acids Res 9(14):3465-81

 [6] Gimautdinova OI., Karpova GG., Kozyreva NA., 1982, [Affinity labeling of ribosomes from Escherichia coli with 4-(N-2-chloroethyl-N-methylamino) benzyl-5'-phosphamides of oligouridylates of different length]., Mol Biol (Mosk) 16(4):752-62

 [7] Gimautdinova OI., Zenkova MA., Karpova GG., Podust LM., 1984, [Affinity modification of Escherichia coli ribosomes with photoactivated analogs of mRNA]., Mol Biol (Mosk) 18(4):907-18

 [8] Graifer DM., Babkina GT., Matasova NB., Vladimirov SN., Karpova GG., Vlassov VV., 1989, Structural arrangement of tRNA binding sites on Escherichia coli ribosomes, as revealed from data on affinity labelling with photoactivatable tRNA derivatives., Biochim Biophys Acta 1008(2):146-56

 [9] Isono S., Isono K., 1978, Mutations affecting the structural genes and the genes coding for modifying enzymes for ribosomal proteins in Escherichia coli., Mol Gen Genet 165(1):15-20

 [10] Janda I., Kitakawa M., Isono K., 1985, Gene rpmF for ribosomal protein L32 and gene rimJ for a ribosomal protein acetylating enzyme are located near pyrC (23.4 min) in Escherichia coli., Mol Gen Genet 201(3):433-6

 [11] Laughrea M., Latulippe J., Filion AM., Boulet L., 1987, Mistranslation in twelve Escherichia coli ribosomal proteins. Cysteine misincorporation at neutral amino acid residues other than tryptophan., Eur J Biochem 169(1):59-64

 [12] Mustoe AM., Busan S., Rice GM., Hajdin CE., Peterson BK., Ruda VM., Kubica N., Nutiu R., Baryza JL., Weeks KM., 2018, Pervasive Regulatory Functions of mRNA Structure Revealed by High-Resolution SHAPE Probing., Cell 173(1):181-195.e18

 [13] Oh W., Larson TJ., 1992, Physical locations of genes in the rne (ams)-rpmF-plsX-fab region of the Escherichia coli K-12 chromosome., J Bacteriol 174(23):7873-4

 [14] Pichon JL., Coeroli C., Marchis-Mouren G., 1977, Studies on ribosomal protein biosynthesis in an RNA polymerase temperature sensitive E. coli mutant., Mol Gen Genet 150(3):257-64

 [15] Podkovyrov S., Larson TJ., 1995, Lipid biosynthetic genes and a ribosomal protein gene are cotranscribed., FEBS Lett 368(3):429-31

 [16] Tanaka Y., Tsujimura A., Fujita N., Isono S., Isono K., 1989, Cloning and analysis of an Escherichia coli operon containing the rpmF gene for ribosomal protein L32 and the gene for a 30-kilodalton protein., J Bacteriol 171(10):5707-12

 [17] Tejedor F., Ballesta JP., 1985, Ribosome structure: binding site of macrolides studied by photoaffinity labeling., Biochemistry 24(2):467-72

 [18] Wittmann-Liebold B., Greuer B., Pannenbecker R., 1975, The primary structure of protein L32 from the 50S subunit of Escherichia coli ribosomes., Hoppe Seylers Z Physiol Chem 356(12):1977-9

 [19] Zhang Y., Cronan JE., 1998, Transcriptional analysis of essential genes of the Escherichia coli fatty acid biosynthesis gene cluster by functional replacement with the analogous Salmonella typhimurium gene cluster., J Bacteriol 180(13):3295-303

 [20] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
