RegulonDB RegulonDB 10.6.3: Gene Form
   

rpoH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

livJ ftsX rpoH ftsE IHF CRP DnaA CytR CytR DnaA CRP CRP Lrp GcvB DksA-ppGpp DksA-ppGpp ppGpp rpoHp1 rpoHp1 rpoHp3 rpoHp3 TSS_4067 TSS_4067 TSS_4066 TSS_4066 rpoHp4 rpoHp4 rpoHp5 rpoHp5 rpoHp6 rpoHp6 livJp livJp TSS_4063 (cluster) TSS_4063 (cluster) TSS_4062 TSS_4062

Gene      
Name: rpoH    Texpresso search in the literature
Synonym(s): ECK3445, EG10897, b3461, fam, hin, htpR
Genome position(nucleotides): 3599929 <-- 3600783 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.15
External database links:  
ASAP:
ABE-0011303
CGSC:
618
ECHOBASE:
EB0890
ECOCYC:
EG10897
ECOLIHUB:
rpoH
OU-MICROARRAY:
b3461
REGULONDB:
b3461
STRING:
511145.b3461
M3D: rpoH
COLOMBOS: rpoH
PortEco: b3461


Product      
Name: RNA polymerase, sigma 32 (sigma H) factor
Synonym(s): sigma;32, Fam, Hin, HtpR, RpoH, sigma 32, sigma 32 factor, sigma H, sigma H factor
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 32.469
Isoelectric point: 5.728
Motif(s):
 
Type Positions Sequence
228 -> 280 AMQGLDERSQDIIRARWLDEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRA
77 -> 80 DLIQ
118 -> 125 LRNWRIVK
193 -> 194 QP
232 -> 284 LDERSQDIIRARWLDEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRAAIEA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.1 - sigma factors, anti-sigmafactors
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.3 - stimulon
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
Gene Ontology Terms (GO)  
cellular_component GO:0031421 - invertasome
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016987 - sigma factor activity
GO:0003700 - DNA-binding transcription factor activity
GO:0009009 - site-specific recombinase activity
GO:0001000 - bacterial-type RNA polymerase core enzyme binding
GO:0000985 - bacterial-type RNA polymerase core promoter sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006310 - DNA recombination
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0009408 - response to heat
GO:0006352 - DNA-templated transcription, initiation
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0010468 - regulation of gene expression
GO:0001121 - bacterial transcription
GO:2000142 - regulation of DNA-templated transcription, initiation
GO:0001123 - transcription initiation from bacterial-type RNA polymerase promoter
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IDA] Inferred from direct assay
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Barros SA., et al., 2016
[2] Grossman AD., et al., 1984
[3] Liberek K., et al., 1992
[4] Meyer AS., et al., 2011
[5] Neidhardt FC., et al., 1983
[6] Straus DB., et al., 1989
[7] Suzuki H., et al., 2012
[8] Tobe T., et al., 1984
[9] Urech C., et al., 2000
[10] Yamamori T., et al., 1982
[11] Yura T., et al., 1984
External database links:  
DIP:
DIP-46203N
ECOCYC:
RPOH-MONOMER
ECOLIWIKI:
b3461
INTERPRO:
IPR007627
INTERPRO:
IPR014284
INTERPRO:
IPR013325
INTERPRO:
IPR013324
INTERPRO:
IPR000943
INTERPRO:
IPR036388
INTERPRO:
IPR007630
INTERPRO:
IPR012759
MINT:
P0AGB3
MODBASE:
P0AGB3
PFAM:
PF04542
PFAM:
PF04545
PRIDE:
P0AGB3
PRINTS:
PR00046
PRODB:
PRO_000023849
PROSITE:
PS00715
PROSITE:
PS00716
PROTEINMODELPORTAL:
P0AGB3
REFSEQ:
NP_417918
SMR:
P0AGB3
UNIPROT:
P0AGB3


Operon      
Name: rpoH         
Operon arrangement:
Transcription unit        Promoter
rpoH
rpoH
rpoH
rpoH
rpoH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, CpxR, IHF
Repressed by: CRP, DnaA, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4062 3599692 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_4063 (cluster) 3599761 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_4066 3600865 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_4067 3600867 reverse nd [RS-EPT-CBR] [12]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Barros SA., Yoon I., Chenoweth DM., 2016, Modulation of the E. coli rpoH Temperature Sensor with Triptycene-Based Small Molecules., Angew Chem Int Ed Engl 55(29):8258-61

 [2] Grossman AD., Erickson JW., Gross CA., 1984, The htpR gene product of E. coli is a sigma factor for heat-shock promoters., Cell 38(2):383-90

 [3] Liberek K., Galitski TP., Zylicz M., Georgopoulos C., 1992, The DnaK chaperone modulates the heat shock response of Escherichia coli by binding to the sigma 32 transcription factor., Proc Natl Acad Sci U S A 89(8):3516-20

 [4] Meyer AS., Baker TA., 2011, Proteolysis in the Escherichia coli heat shock response: a player at many levels., Curr Opin Microbiol 14(2):194-9

 [5] Neidhardt FC., VanBogelen RA., Lau ET., 1983, Molecular cloning and expression of a gene that controls the high-temperature regulon of Escherichia coli., J Bacteriol 153(2):597-603

 [6] Straus DB., Walter WA., Gross CA., 1989, The activity of sigma 32 is reduced under conditions of excess heat shock protein production in Escherichia coli., Genes Dev 3(12A):2003-10

 [7] Suzuki H., Ikeda A., Tsuchimoto S., Adachi K., Noguchi A., Fukumori Y., Kanemori M., 2012, Synergistic binding of DnaJ and DnaK chaperones to heat shock transcription factor σ32 ensures its characteristic high metabolic instability: implications for heat shock protein 70 (Hsp70)-Hsp40 mode of function., J Biol Chem 287(23):19275-83

 [8] Tobe T., Ito K., Yura T., 1984, Isolation and physical mapping of temperature-sensitive mutants defective in heat-shock induction of proteins in Escherichia coli., Mol Gen Genet 195(1-2):10-6

 [9] Urech C., Koby S., Oppenheim AB., Munchbach M., Hennecke H., Narberhaus F., 2000, Differential degradation of Escherichia coli sigma32 and Bradyrhizobium japonicum RpoH factors by the FtsH protease., Eur J Biochem 267(15):4831-9

 [10] Yamamori T., Yura T., 1982, Genetic control of heat-shock protein synthesis and its bearing on growth and thermal resistance in Escherichia coli K-12., Proc Natl Acad Sci U S A 79(3):860-4

 [11] Yura T., Tobe T., Ito K., Osawa T., 1984, Heat shock regulatory gene (htpR) of Escherichia coli is required for growth at high temperature but is dispensable at low temperature., Proc Natl Acad Sci U S A 81(21):6803-7

 [12] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB