RegulonDB RegulonDB 10.8: Gene Form
   

rpsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpsA cmk ihfB IHF IHF IHF IHF IHF IHF DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp anti-terminator anti-anti-terminator terminator anti-terminator anti-anti-terminator ycaIp8 ycaIp8 ycaIp6 ycaIp6 TSS_1188 TSS_1188 ihfBp ihfBp TSS_1187 (cluster) TSS_1187 (cluster) TSS_1186 (cluster) TSS_1186 (cluster) TSS_1185 (cluster) TSS_1185 (cluster) TSS_1184 TSS_1184 TSS_1183 TSS_1183 TSS_1182 (cluster) TSS_1182 (cluster) TSS_1181 TSS_1181 TSS_1180 TSS_1180 TSS_1179 (cluster) TSS_1179 (cluster) rpsAp3 rpsAp3 TSS_1178 TSS_1178 rpsAp1 rpsAp1

Gene      
Name: rpsA    Texpresso search in the literature
Synonym(s): ECK0902, EG10900, b0911, ssyF
Genome position(nucleotides): 961995 --> 963668 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.19
External database links:  
ASAP:
ABE-0003104
CGSC:
230
ECHOBASE:
EB0893
OU-MICROARRAY:
b0911
PortEco:
rpsA
STRING:
511145.b0911
COLOMBOS: rpsA


Product      
Name: 30S ribosomal subunit protein S1
Synonym(s): RpsA, SsyF
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 61.158
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
277 -> 347 GTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLK
104 -> 171 DAETVTGVINGKVKGGFTVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVVSRR
208 -> 208 F
219 -> 219 H
361 -> 434 HNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERERISLGVK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005840 - ribosome
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003676 - nucleic acid binding
GO:0003735 - structural constituent of ribosome
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
biological_process GO:0006412 - translation
GO:0000028 - ribosomal small subunit assembly
GO:2000766 - negative regulation of cytoplasmic translation
Note(s): Note(s): ...[more].
Reference(s): [1] Duval M., et al., 2013
[2] Osterberg R., et al., 1978
[3] Pan JY., et al., 2011
External database links:  
DIP:
DIP-35884N
ECOCYC:
EG10900-MONOMER
ECOLIWIKI:
b0911
INTERPRO:
IPR000110
INTERPRO:
IPR022967
INTERPRO:
IPR012340
INTERPRO:
IPR003029
MINT:
P0AG67
MODBASE:
P0AG67
PDB:
6H58
PDB:
6BU8
PDB:
5XQ5
PDB:
4R71
PDB:
4Q7J
PDB:
2KHJ
PDB:
2KHI
PDB:
2BH8
PDB:
6H4N
PFAM:
PF00575
PRIDE:
P0AG67
PRINTS:
PR00681
PRODB:
PRO_000023854
PROSITE:
PS50126
REFSEQ:
NP_415431
SMART:
SM00316
SMR:
P0AG67
UNIPROT:
P0AG67


Operon      
Name: cmk-rpsA-ihfB         
Operon arrangement:
Transcription unit        Promoter
cmk-rpsA
rpsA-ihfB
rpsA-ihfB
ihfB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1178 961718 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1179 (cluster) 961893 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1180 961899 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1181 962373 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1182 (cluster) 962813 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1183 962831 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1184 962837 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1185 (cluster) 963236 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1186 (cluster) 963240 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1187 (cluster) 963362 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1188 964101 forward nd [RS-EPT-CBR] [4]
  promoter ycaIp6 964105 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ycaIp8 964108 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Duval M., Korepanov A., Fuchsbauer O., Fechter P., Haller A., Fabbretti A., Choulier L., Micura R., Klaholz BP., Romby P., Springer M., Marzi S., 2013, Escherichia coli ribosomal protein S1 unfolds structured mRNAs onto the ribosome for active translation initiation., PLoS Biol 11(12):e1001731

 [2] Osterberg R., Sjoberg B., 1978, Small-angle X-ray scattering study of the proteins S1, S8, S15, S16, S20 from Escherichia coli ribosomes., FEBS Lett 93(1):115-9

 [3] Pan JY., Wu H., Liu X., Li PP., Li H., Wang SY., Peng XX., 2011, Complexome of Escherichia coli cytosolic proteins under normal native conditions., Mol Biosyst 7(9):2651-63

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB