RegulonDB RegulonDB 10.9: Gene Form
   

rpsJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rplC gspB rpsJ DksA-ppGpp DksA-ppGpp TSS_3833 TSS_3833 rpsJp rpsJp TSS_3832 TSS_3832 TSS_3831 TSS_3831 TSS_3830 TSS_3830 TSS_3829 TSS_3829 TSS_3828 TSS_3828 TSS_3827 TSS_3827 TSS_3826 TSS_3826 TSS_3825 (cluster) TSS_3825 (cluster) TSS_3824 (cluster) TSS_3824 (cluster) TSS_3823 (cluster) TSS_3823 (cluster) TSS_3822 TSS_3822 TSS_3821 TSS_3821 TSS_3820 (cluster) TSS_3820 (cluster) TSS_3819 TSS_3819 TSS_3818 TSS_3818

Gene      
Name: rpsJ    Texpresso search in the literature
Synonym(s): ECK3308, EG10909, b3321, nusE
Genome position(nucleotides): 3452959 <-- 3453270 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.45
External database links:  
ASAP:
ABE-0010862
CGSC:
222
ECHOBASE:
EB0902
ECOLIHUB:
rpsJ
OU-MICROARRAY:
b3321
STRING:
511145.b3321
COLOMBOS: rpsJ


Product      
Name: 30S ribosomal subunit protein S10
Synonym(s): NusE, RpsJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 11.736
Isoelectric point: 10.35
Motif(s):
 
Type Positions Sequence
7 -> 100 RIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015935 - small ribosomal subunit
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0006412 - translation
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
Reference(s): [1] Das R., et al., 2008
[2] Luo X., et al., 2008
[3] Mason SW., et al., 1991
[4] Sullivan SL., et al., 1992
External database links:  
DIP:
DIP-35797N
ECOCYC:
EG10909-MONOMER
ECOLIWIKI:
b3321
INTERPRO:
IPR001848
INTERPRO:
IPR018268
INTERPRO:
IPR036838
INTERPRO:
IPR027486
MODBASE:
P0A7R5
PANTHER:
PTHR11700
PDB:
1M5G
PDB:
2KVQ
PDB:
2YKR
PDB:
3D3B
PDB:
3D3C
PDB:
3IMQ
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
3W1Y
PDB:
4A2I
PDB:
4ADV
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5AFI
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5ME0
PDB:
5ME1
PDB:
5MGP
PDB:
5MS0
PDB:
5MY1
PDB:
5NO2
PDB:
5NO3
PDB:
5NO4
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5UZ4
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I7V
PDB:
6NQB
PDB:
6O9J
PDB:
6O9K
PDB:
6OFX
PDB:
6OG7
PDB:
6ORE
PDB:
6ORL
PDB:
6OST
PDB:
6OT3
PDB:
6OUO
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6SZS
PDB:
6TBV
PDB:
6TC3
PFAM:
PF00338
PRIDE:
P0A7R5
PRINTS:
PR00971
PRODB:
PRO_000023863
PROSITE:
PS00361
REFSEQ:
NP_417780
SMART:
SM01403
SMR:
P0A7R5
UNIPROT:
P0A7R5


Operon      
Name: rpsJ-rplCDWB-rpsS-rplV-rpsC-rplP-rpmC-rpsQ         
Operon arrangement:
Transcription unit        Promoter
rpsJ-rplCDWB-rpsS-rplV-rpsC-rplP-rpmC-rpsQ


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3818 3452609 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3819 3453214 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3820 (cluster) 3453225 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_3821 3453229 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3822 3453234 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3823 (cluster) 3453240 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_3824 (cluster) 3453244 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_3825 (cluster) 3453252 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_3826 3453255 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3827 3453263 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3828 3453271 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3829 3453287 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3830 3453290 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3831 3453439 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3832 3453441 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3833 3453450 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Das R., Loss S., Li J., Waugh DS., Tarasov S., Wingfield PT., Byrd RA., Altieri AS., 2008, Structural biophysics of the NusB:NusE antitermination complex., J Mol Biol 376(3):705-20

 [2] Luo X., Hsiao HH., Bubunenko M., Weber G., Court DL., Gottesman ME., Urlaub H., Wahl MC., 2008, Structural and functional analysis of the E. coli NusB-S10 transcription antitermination complex., Mol Cell 32(6):791-802

 [3] Mason SW., Greenblatt J., 1991, Assembly of transcription elongation complexes containing the N protein of phage lambda and the Escherichia coli elongation factors NusA, NusB, NusG, and S10., Genes Dev 5(8):1504-12

 [4] Sullivan SL., Ward DF., Gottesman ME., 1992, Effect of Escherichia coli nusG function on lambda N-mediated transcription antitermination., J Bacteriol 174(4):1339-44

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB