RegulonDB RegulonDB 10.6.3: Gene Form
   

ftnA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftnA yecR yecH H-NS H-NS H-NS Fur Fur Fur H-NS Fur Fur H-NS H-NS terminator TSS_2242 TSS_2242 ftnAp ftnAp

Gene      
Name: ftnA    Texpresso search in the literature
Synonym(s): ECK1904, EG10921, b1905, ftn, gen-165, rsgA
Genome position(nucleotides): 1988716 --> 1989213 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.77
External database links:  
ASAP:
ABE-0006342
CGSC:
32521
ECHOBASE:
EB0914
ECOCYC:
EG10921
ECOLIHUB:
ftnA
OU-MICROARRAY:
b1905
REGULONDB:
b1905
STRING:
511145.b1905
M3D: ftnA
COLOMBOS: ftnA
PortEco: b1905


Product      
Name: ferritin iron storage protein
Synonym(s): Ftn, FtnA, RsgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell wall,extracellular space,cytosol
Molecular weight: 19.424
Isoelectric point: 4.495
Motif(s):
 
Type Positions Sequence
94 -> 94 E
17 -> 17 E
53 -> 53 H
130 -> 130 E
1 -> 145 MLKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0005576 - extracellular region
GO:0005618 - cell wall
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004322 - ferroxidase activity
GO:0005506 - iron ion binding
GO:0008198 - ferrous iron binding
GO:0008199 - ferric iron binding
GO:0042802 - identical protein binding
biological_process GO:0071281 - cellular response to iron ion
GO:0006826 - iron ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0006979 - response to oxidative stress
GO:0006879 - cellular iron ion homeostasis
GO:0055114 - oxidation-reduction process
GO:0006880 - intracellular sequestering of iron ion
GO:0001666 - response to hypoxia
GO:0051409 - response to nitrosative stress
Note(s): Note(s): ...[more].
Reference(s): [1] Sevcenco AM., et al., 2011
External database links:  
DIP:
DIP-36198N
ECOCYC:
EG10921-MONOMER
ECOLIWIKI:
b1905
INTERPRO:
IPR012347
INTERPRO:
IPR009078
INTERPRO:
IPR009040
INTERPRO:
IPR008331
INTERPRO:
IPR001519
MODBASE:
P0A998
PANTHER:
PTHR11431
PDB:
4ZTT
PDB:
1EUM
PDB:
4XGS
PFAM:
PF00210
PRIDE:
P0A998
PRODB:
PRO_000022712
PROSITE:
PS50905
PROTEINMODELPORTAL:
P0A998
REFSEQ:
NP_416418
SMR:
P0A998
UNIPROT:
P0A998


Operon      
Name: ftnA         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: Fur
Repressed by: H-NS


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2242 1988699 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sevcenco AM., Pinkse MW., Wolterbeek HT., Verhaert PD., Hagen WR., Hagedoorn PL., 2011, Exploring the microbial metalloproteome using MIRAGE., Metallomics 3(12):1324-30

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB