RegulonDB RegulonDB 10.8: Gene Form
   

ruvC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebC yebB ruvC ruvCp ruvCp

Gene      
Name: ruvC    Texpresso search in the literature
Synonym(s): ECK1864, EG10925, b1863
Genome position(nucleotides): 1946855 <-- 1947376 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.94
External database links:  
ASAP:
ABE-0006215
CGSC:
32474
ECHOBASE:
EB0918
OU-MICROARRAY:
b1863
PortEco:
ruvC
STRING:
511145.b1863
COLOMBOS: ruvC


Product      
Name: crossover junction endodeoxyribonuclease RuvC
Synonym(s): Holliday junction nuclease, resolution of structures, repair, RuvC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.747
Isoelectric point: 9.984
Motif(s):
 
Type Positions Sequence
4 -> 150 ILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITH
2 -> 173 AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0048476 - Holliday junction resolvase complex
molecular_function GO:0003676 - nucleic acid binding
GO:0004518 - nuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004520 - endodeoxyribonuclease activity
GO:0008821 - crossover junction endodeoxyribonuclease activity
GO:0000287 - magnesium ion binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009314 - response to radiation
GO:0000725 - recombinational repair
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0071932 - replication fork reversal
Note(s): Note(s): ...[more].
Reference(s): [1] Zhou R., et al., 2019
External database links:  
DIP:
DIP-35952N
ECOCYC:
EG10925-MONOMER
ECOLIWIKI:
b1863
INTERPRO:
IPR020563
INTERPRO:
IPR036397
INTERPRO:
IPR012337
INTERPRO:
IPR002176
PANTHER:
PTHR30194
PDB:
1HJR
PFAM:
PF02075
PRIDE:
P0A814
PRINTS:
PR00696
PRODB:
PRO_000023902
PROSITE:
PS01321
REFSEQ:
NP_416377
SMR:
P0A814
UNIPROT:
P0A814


Operon      
Name: nudB-yebC-ruvC         
Operon arrangement:
Transcription unit        Promoter
ruvC
yebC-ruvC
nudB-yebC-ruvC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Zhou R., Yang O., Declais AC., Jin H., Gwon GH., Freeman ADJ., Cho Y., Lilley DMJ., Ha T., 2019, Junction resolving enzymes use multivalency to keep the Holliday junction dynamic., Nat Chem Biol 15(3):269-275


RegulonDB