RegulonDB RegulonDB 10.8: Gene Form
   

sdaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeD sdaA nudL TSS_2139 TSS_2139 sdaAp sdaAp

Gene      
Name: sdaA    Texpresso search in the literature
Synonym(s): ECK1812, EG10930, b1814
Genome position(nucleotides): 1896932 --> 1898296 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.99
External database links:  
ASAP:
ABE-0006039
CGSC:
32312
ECHOBASE:
EB0923
OU-MICROARRAY:
b1814
PortEco:
sdaA
STRING:
511145.b1814
COLOMBOS: sdaA


Shine dalgarno      
Sequence: gtccagtcacCTTGTCaggagtattatcGTG


Product      
Name: L-serine deaminase I
Synonym(s): L-SD, L-SD1, SDH-1, SDH1, SdaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.907
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
186 -> 448 YSLSGLAMQNELALHSKKEIDEYFAHVWQTMQACIDRGMNTEGVLPGPLRVPRRASALRRMLVSSDKLSNDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYYDHFIESVSPDIYTRYFMAAGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGGSPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMALRRTSAPRVSLDKVIETMYETGKDMNAKYRETSRGGLA
3 -> 155 SLFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLDSVTRVAVDVYGSLSLTGKGHHTDIAIIMGLAGNEPATVDIDSIPGFIRDVEERERLLLAQGRHEVDFPRDNGMRFHNGNLPLHENGMQIHAYNGDEVVYSKTYYSIGGGFIVDEE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0003941 - L-serine ammonia-lyase activity
biological_process GO:0006094 - gluconeogenesis
GO:0006565 - L-serine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
LSERINEDEAM1-MONOMER
ECOLIWIKI:
b1814
INTERPRO:
IPR029009
INTERPRO:
IPR005131
INTERPRO:
IPR005130
INTERPRO:
IPR004644
PFAM:
PF03313
PFAM:
PF03315
PRIDE:
P16095
PRODB:
PRO_000023915
REFSEQ:
NP_416328
SMR:
P16095
UNIPROT:
P16095


Operon      
Name: sdaA         
Operon arrangement:
Transcription unit        Promoter
sdaA


Transcriptional Regulation      
Display Regulation             
Repressed by: Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2139 1896882 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB