RegulonDB RegulonDB 10.8: Gene Form
   

sdhA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sdhA sdhB sdhC sdhD CRP ArcA TSS_845 TSS_845 TSS_844 (cluster) TSS_844 (cluster) TSS_843 (cluster) TSS_843 (cluster) TSS_842 TSS_842 TSS_841 TSS_841 TSS_840 TSS_840 sdhDp2 sdhDp2

Gene      
Name: sdhA    Texpresso search in the literature
Synonym(s): ECK0712, EG10931, b0723, dhsA
Genome position(nucleotides): 755907 --> 757673 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.31
External database links:  
ASAP:
ABE-0002466
CGSC:
17908
ECHOBASE:
EB0924
MIM:
614165
MIM:
256000
MIM:
252011
MIM:
613642
OU-MICROARRAY:
b0723
PortEco:
sdhA
STRING:
511145.b0723
COLOMBOS: sdhA


Product      
Name: succinate:quinone oxidoreductase, FAD binding protein
Synonym(s): DhsA, SdhA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 64.422
Isoelectric point: 6.211
Motif(s):
 
Type Positions Sequence
404 -> 405 SL
9 -> 405 DAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSL
37 -> 52 SKVFPTRSHTVSAQGG
14 -> 19 GAGGAG
460 -> 588 RKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0045282 - plasma membrane succinate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0016491 - oxidoreductase activity
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0050660 - flavin adenine dinucleotide binding
GO:0008177 - succinate dehydrogenase (ubiquinone) activity
GO:0000104 - succinate dehydrogenase activity
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0009060 - aerobic respiration
GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Condon C., et al., 1985
[2] Wood D., et al., 1984
External database links:  
DIP:
DIP-31877N
ECOCYC:
SDH-FLAVO
ECOLIWIKI:
b0723
INTERPRO:
IPR003952
INTERPRO:
IPR015939
INTERPRO:
IPR027477
INTERPRO:
IPR003953
INTERPRO:
IPR011281
INTERPRO:
IPR014006
INTERPRO:
IPR037099
INTERPRO:
IPR036188
MINT:
P0AC41
MODBASE:
P0AC41
PANTHER:
PTHR11632:SF5
PDB:
2WU5
PDB:
2WS3
PDB:
2WP9
PDB:
2WDV
PDB:
2WDR
PDB:
2WDQ
PDB:
2AD0
PDB:
2ACZ
PDB:
1NEN
PDB:
1NEK
PDB:
2WU2
PFAM:
PF00890
PFAM:
PF02910
PRIDE:
P0AC41
PRINTS:
PR00368
PRODB:
PRO_000023918
PROSITE:
PS00504
REFSEQ:
NP_415251
SMR:
P0AC41
UNIPROT:
P0AC41


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_840 755805 forward nd [RS-EPT-CBR] [3]
  promoter TSS_841 755883 forward nd [RS-EPT-CBR] [3]
  promoter TSS_842 756352 forward nd [RS-EPT-CBR] [3]
  promoter TSS_843 (cluster) 758036 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_844 (cluster) 758044 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_845 758063 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Condon C., Cammack R., Patil DS., Owen P., 1985, The succinate dehydrogenase of Escherichia coli. Immunochemical resolution and biophysical characterization of a 4-subunit enzyme complex., J Biol Chem 260(16):9427-34

 [2] Wood D., Darlison MG., Wilde RJ., Guest JR., 1984, Nucleotide sequence encoding the flavoprotein and hydrophobic subunits of the succinate dehydrogenase of Escherichia coli., Biochem J 222(2):519-34

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB