RegulonDB RegulonDB 10.8: Gene Form
   

sdhD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sdhA sdhB sdhC sdhD ybgU ybgV CRP ArcA ArcA ArcA Fur CRP IHF ArcA ArcA ArcA TSS_845 TSS_845 TSS_844 (cluster) TSS_844 (cluster) TSS_843 (cluster) TSS_843 (cluster) TSS_842 TSS_842 TSS_841 TSS_841 TSS_840 TSS_840 sdhDp2 sdhDp2 sdhCp sdhCp gltAp1 gltAp1 TSS_839 TSS_839

Gene      
Name: sdhD    Texpresso search in the literature
Synonym(s): ECK0711, EG10934, b0722, cybS, dhsD
Genome position(nucleotides): 755560 --> 755907 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.15
External database links:  
ASAP:
ABE-0002464
CGSC:
17899
ECHOBASE:
EB0927
OU-MICROARRAY:
b0722
PortEco:
sdhD
STRING:
511145.b0722
COLOMBOS: sdhD


Product      
Name: succinate:quinone oxidoreductase, membrane protein SdhD
Synonym(s): CybS, DhsD, SdhD, small subunit of cytochrome b556
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.868
Isoelectric point: 8.873
Motif(s):
 
Type Positions Sequence
59 -> 80 VFTLLALFSILIHAWIGMWQVL
91 -> 115 LMLQLVIVVALVVYVIYGFVVVWGV
11 -> 105 NGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYV
16 -> 36 FILVRATAIVLTLYIIYMVGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0000104 - succinate dehydrogenase activity
GO:0020037 - heme binding
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0009060 - aerobic respiration
GO:0017004 - cytochrome complex assembly
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10838N
ECOCYC:
SDH-MEMB2
ECOLIWIKI:
b0722
INTERPRO:
IPR000701
INTERPRO:
IPR034804
INTERPRO:
IPR014312
MODBASE:
P0AC44
PANTHER:
PTHR38689
PDB:
2WDR
PDB:
2WDV
PDB:
2WP9
PDB:
2WU2
PDB:
2WU5
PDB:
2WDQ
PDB:
2AD0
PDB:
2ACZ
PDB:
1NEN
PDB:
1NEK
PDB:
2WS3
PFAM:
PF01127
PRIDE:
P0AC44
PRODB:
PRO_000023921
REFSEQ:
NP_415250
SMR:
P0AC44
UNIPROT:
P0AC44


Operon      
Name: sdhCDAB-sucABCD-sdhX         
Operon arrangement:
Transcription unit        Promoter
sdhCDAB-sucABCD-sdhX
sdhDAB
sucAB
sucABCD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fur, ArcA
Repressed by: FNR, ArcA


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_839 754683 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_840 755805 forward nd [RS-EPT-CBR] [1]
  promoter TSS_841 755883 forward nd [RS-EPT-CBR] [1]
  promoter TSS_842 756352 forward nd [RS-EPT-CBR] [1]
  promoter TSS_843 (cluster) 758036 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_844 (cluster) 758044 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_845 758063 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB