RegulonDB RegulonDB 10.6.3: Gene Form
   

sdiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sdiA yecF sdsN yecU sdiAp1 sdiAp1 sdiAp1b sdiAp1b sdsNp sdsNp sdiAp2 sdiAp2 sdiAp2b sdiAp2b sdsNp2 sdsNp2 sdiAp3 sdiAp3 sdiAp4 sdiAp4 sdiAp6 sdiAp6

Gene      
Name: sdiA    Texpresso search in the literature
Synonym(s): ECK1915, EG10935, b1916
Genome position(nucleotides): 1996110 <-- 1996832 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.75
External database links:  
ASAP:
ABE-0006381
CGSC:
30919
ECHOBASE:
EB0928
ECOCYC:
EG10935
ECOLIHUB:
sdiA
OU-MICROARRAY:
b1916
REGULONDB:
b1916
STRING:
511145.b1916
M3D: sdiA
COLOMBOS: sdiA
PortEco: b1916


Product      
Name: DNA-binding transcriptional dual regulator SdiA
Synonym(s): SdiA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 28.117
Isoelectric point: 7.044
Motif(s):
 
Type Positions Sequence
140 -> 140 A
22 -> 159 TAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPNRALGFLSFSRCSAREIPILSDELQLKMQLLVR
197 -> 216 SAEIAMILSISENTVNFHQK
173 -> 238 VMTPEMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATG
120 -> 128 TQYLMLPNR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0051301 - cell division
GO:0006355 - regulation of transcription, DNA-templated
GO:0007049 - cell cycle
GO:2000144 - positive regulation of DNA-templated transcription, initiation
GO:0032467 - positive regulation of cytokinesis
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
ECOCYC:
PD02198
ECOLIWIKI:
b1916
INTERPRO:
IPR005143
INTERPRO:
IPR036693
INTERPRO:
IPR036388
INTERPRO:
IPR016032
INTERPRO:
IPR000792
MODBASE:
P07026
PDB:
2AVX
PDB:
4LFU
PDB:
4LGW
PFAM:
PF03472
PFAM:
PF00196
PRIDE:
P07026
PRINTS:
PR00038
PRODB:
PRO_000023922
PROSITE:
PS00622
PROSITE:
PS50043
PROTEINMODELPORTAL:
P07026
REFSEQ:
NP_416426
SMART:
SM00421
SMR:
P07026
UNIPROT:
P07026


Operon      
Name: sdiA         
Operon arrangement:
Transcription unit        Promoter
sdiA
sdiA
sdiA
null
sdiA
sdiA
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sdiAp6 1996851 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB