RegulonDB RegulonDB 10.8: Gene Form
   

selD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

topB selD ydjA TSS_2072 TSS_2072 selDp2 selDp2 selDp1 selDp1 TSS_2071 TSS_2071 ynjIp1 ynjIp1

Gene      
Name: selD    Texpresso search in the literature
Synonym(s): ECK1762, EG10943, b1764, fdhB
Genome position(nucleotides): 1846965 <-- 1848008 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.98
External database links:  
ASAP:
ABE-0005872
CGSC:
32292
ECHOBASE:
EB0936
OU-MICROARRAY:
b1764
PortEco:
selD
STRING:
511145.b1764
COLOMBOS: selD


Product      
Name: selenide, water dikinase
Synonym(s): FdhB, SelD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.687
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
19 -> 19 C
169 -> 344 QAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLSEMCQGAGVQARVDYEAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQTSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGGRAMV
18 -> 18 G
20 -> 20 K
50 -> 157 DDAAVYDLGNGTSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004756 - selenide, water dikinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0016310 - phosphorylation
GO:0016260 - selenocysteine biosynthetic process
GO:0070329 - tRNA seleno-modification
External database links:  
DIP:
DIP-10849N
ECOCYC:
EG10943-MONOMER
ECOLIWIKI:
b1764
INTERPRO:
IPR036921
INTERPRO:
IPR036676
INTERPRO:
IPR023061
INTERPRO:
IPR016188
INTERPRO:
IPR010918
INTERPRO:
IPR004536
MINT:
MINT-1256873
MODBASE:
P16456
PANTHER:
PTHR10256
PDB:
3U0O
PFAM:
PF02769
PFAM:
PF00586
PRIDE:
P16456
PRODB:
PRO_000023932
REFSEQ:
NP_416278
SMR:
P16456
UNIPROT:
P16456


Operon      
Name: ydjA-selD-topB         
Operon arrangement:
Transcription unit        Promoter
selD-topB
selD-topB
ydjA-selD-topB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynjIp1 1845011 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2071 1847772 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2072 1848030 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB