RegulonDB RegulonDB 10.8: Gene Form
   

serA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

serA rpiA sibC ibsC CRP Nac Nac SibC serAp2 serAp2 serAp1 serAp1 TSS_3203 TSS_3203 TSS_3202 (cluster) TSS_3202 (cluster) TSS_3201 TSS_3201 TSS_3200 TSS_3200 TSS_3199 TSS_3199 TSS_3198 TSS_3198 TSS_3197 TSS_3197 TSS_3196 TSS_3196 TSS_3195 TSS_3195 TSS_3194 TSS_3194 TSS_3193 TSS_3193

Gene      
Name: serA    Texpresso search in the literature
Synonym(s): ECK2909, EG10944, b2913
Genome position(nucleotides): 3057178 <-- 3058410 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.96
External database links:  
ASAP:
ABE-0009561
CGSC:
173
ECHOBASE:
EB0937
MIM:
256520
MIM:
601815
OU-MICROARRAY:
b2913
PortEco:
serA
STRING:
511145.b2913
COLOMBOS: serA


Product      
Name: phosphoglycerate dehydrogenase
Synonym(s): SerA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.176
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence
238 -> 240 ASR
292 -> 295 HIGG
345 -> 401 ENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDIEADEDVAEKALQAMKAIP
2 -> 410 AKVSLEKDKIKFLLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGLRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVNFPEVSLPLHGGRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDIEADEDVAEKALQAMKAIPGTIRARLLY
14 -> 326 LLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGLRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.11 - serine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004617 - phosphoglycerate dehydrogenase activity
GO:0047545 - 2-hydroxyglutarate dehydrogenase activity
GO:0030267 - glyoxylate reductase (NADP) activity
GO:0042802 - identical protein binding
GO:0051287 - NAD binding
GO:0016618 - hydroxypyruvate reductase activity
GO:0070403 - NAD+ binding
GO:0070905 - serine binding
GO:0070404 - NADH binding
biological_process GO:0006564 - L-serine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Burton RL., et al., 2009
[2] Deng H., et al., 2016
[3] Kim HJ., et al., 2013
[4] Li Y., et al., 2012
[5] Mundhada H., et al., 2016
[6] Tobey KL., et al., 1986
External database links:  
DIP:
DIP-10851N
ECOCYC:
PGLYCDEHYDROG-MONOMER
ECOLIWIKI:
b2913
INTERPRO:
IPR002912
INTERPRO:
IPR036291
INTERPRO:
IPR029753
INTERPRO:
IPR029752
INTERPRO:
IPR006140
INTERPRO:
IPR006139
PANTHER:
PTHR10996:SF165
PDB:
2P9G
PDB:
2PA3
PDB:
1PSD
PDB:
1SC6
PDB:
1YBA
PDB:
2P9C
PDB:
2P9E
PFAM:
PF01842
PFAM:
PF02826
PFAM:
PF00389
PRIDE:
P0A9T0
PROSITE:
PS00671
PROSITE:
PS00670
PROSITE:
PS00065
PROSITE:
PS51671
REFSEQ:
NP_417388
SMR:
P0A9T0
UNIPROT:
P0A9T0


Operon      
Name: serA         
Operon arrangement:
Transcription unit        Promoter
serA
serA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Lrp
Repressed by: Nac, Lrp


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  srna SibC 3056890 3056949 reverse unknow. nd nd
  promoter TSS_3193 3057340 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3194 3057467 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3195 3057593 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3196 3057726 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3197 3057734 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3198 3058242 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3199 3058303 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3200 3058379 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3201 3058419 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3202 (cluster) 3058434 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_3203 3058455 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Burton RL., Chen S., Xu XL., Grant GA., 2009, Transient kinetic analysis of the interaction of L-serine with Escherichia coli D-3-phosphoglycerate dehydrogenase reveals the mechanism of V-type regulation and the order of effector binding., Biochemistry 48(51):12242-51

 [2] Deng H., Chen C., Sun C., Wei C., 2016, [Construction and characterization of Escherichia coli D-3-phosphoglycerate dehydrogenase mutants with feedback-inhibition relief]., Sheng Wu Gong Cheng Xue Bao 32(4):468-477

 [3] Kim HJ., Hou BK., Lee SG., Kim JS., Lee DW., Lee SJ., 2013, Genome-wide analysis of redox reactions reveals metabolic engineering targets for D-lactate overproduction in Escherichia coli., Metab Eng 18:44-52

 [4] Li Y., Chen GK., Tong XW., Zhang HT., Liu XG., Liu YH., Lu FP., 2012, Construction of Escherichia coli strains producing L-serine from glucose., Biotechnol Lett 34(8):1525-30

 [5] Mundhada H., Schneider K., Christensen HB., Nielsen AT., 2016, Engineering of high yield production of L-serine in Escherichia coli., Biotechnol Bioeng 113(4):807-16

 [6] Tobey KL., Grant GA., 1986, The nucleotide sequence of the serA gene of Escherichia coli and the amino acid sequence of the encoded protein, D-3-phosphoglycerate dehydrogenase., J Biol Chem 261(26):12179-83

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB