RegulonDB RegulonDB 10.8: Gene Form
   

serC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroA serC ycaP CRP Lrp anti-terminator anti-anti-terminator terminator anti-terminator anti-anti-terminator TSS_1177 (cluster) TSS_1177 (cluster) TSS_1176 TSS_1176 TSS_1175 TSS_1175 TSS_1174 TSS_1174 TSS_1173 TSS_1173 TSS_1172 TSS_1172 serCp serCp TSS_1171 TSS_1171 serCp2 serCp2

Gene      
Name: serC    Texpresso search in the literature
Synonym(s): ECK0898, EG10946, b0907, pdxC, pdxF
Genome position(nucleotides): 957653 --> 958741 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.14
External database links:  
ASAP:
ABE-0003093
CGSC:
171
ECHOBASE:
EB0939
MIM:
610992
MIM:
616038
OU-MICROARRAY:
b0907
PortEco:
serC
STRING:
511145.b0907
COLOMBOS: serC


Product      
Name: phosphoserine/phosphohydroxythreonine aminotransferase
Synonym(s): PdxC, PdxF, SerC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.783
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
76 -> 77 GR
2 -> 362 AQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRHG
293 -> 293 A
239 -> 240 NT
4 -> 350 IFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSSTILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.11 - serine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0004648 - O-phospho-L-serine:2-oxoglutarate aminotransferase activity
GO:0030170 - pyridoxal phosphate binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006563 - L-serine metabolic process
GO:0006564 - L-serine biosynthetic process
GO:0008615 - pyridoxine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0042823 - pyridoxal phosphate biosynthetic process
GO:0033359 - lysine biosynthetic process via diaminopimelate and N-succinyl-2-amino-6-ketopimelate
Note(s): Note(s): ...[more].
Reference(s): [1] Grant GA. 2018
[2] Gu P., et al., 2014
[3] Ivancic T., et al., 2013
[4] Mundhada H., et al., 2016
[5] Smallbone K., et al., 2013
[6] Wintermute EH., et al., 2010
[7] Zhang Y., et al., 2019
External database links:  
DIP:
DIP-2896N
ECOCYC:
PSERTRANSAM-MONOMER
ECOLIWIKI:
b0907
INTERPRO:
IPR000192
INTERPRO:
IPR022278
INTERPRO:
IPR020578
INTERPRO:
IPR015424
INTERPRO:
IPR015422
INTERPRO:
IPR015421
MINT:
MINT-1249760
MODBASE:
P23721
PANTHER:
PTHR21152:SF1
PDB:
1BJO
PDB:
1BJN
PFAM:
PF00266
PRIDE:
P23721
PROSITE:
PS00595
REFSEQ:
NP_415427
SMR:
P23721
UNIPROT:
P23721


Operon      
Name: serC-aroA         
Operon arrangement:
Transcription unit        Promoter
serC
serC
serC-aroA


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp
Repressed by: CRP
Growth Conditions:

[1] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| early to mid exponential phase
E: Escherichia coli| minimal medium| cAMP 1 mM; glucose 0.4%| 37.0 C| early to mid exponential phase

[2] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| early to mid exponential phase
E: Escherichia coli| minimal medium| glucose 0.4%; leucine 0.76 mM| 37.0 C| early to mid exponential phase

[3] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| LB medium| 37.0 C| exponential phase

[4] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| minimal medium| glycerol 1%| 37.0 C| exponential phase

[5] 

C: Escherichia coli| lrp knockout mutant| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| lrp knockout mutant| LB medium| 37.0 C| exponential phase

[6] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| lrp knockout mutant| minimal medium| glucose 0.4%| 37.0 C| exponential phase

[7] 

C: Escherichia coli| LB medium| 37.0 C| exponential phase
E: Escherichia coli| cyaA knockout mutant| LB medium| 37.0 C| exponential phase

[8] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| minimal medium| glucose 0.4%; vitamin assay casamino acids 0.5%| 37.0 C| exponential phase

[9] 

C: Escherichia coli| LB medium| 37.0 C| exponential phase
E: Escherichia coli| crp knockout mutant; lrp knockout mutant| LB medium| 37.0 C| exponential phase

[10] 

C: Escherichia coli| LB medium| 37.0 C| exponential phase
E: Escherichia coli| crp knockout mutant| LB medium| 37.0 C| exponential phase

[11] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| crp knockout mutant| minimal medium| glucose 0.4%| 37.0 C| exponential phase

[12] 

C: Escherichia coli| minimal medium| glucose 0.4%| 37.0 C| exponential phase
E: Escherichia coli| crp knockout mutant; lrp knockout mutant| minimal medium| glucose 0.4%| 37.0 C| exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1171 957585 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1172 957945 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1173 958104 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1174 958585 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1175 958602 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1176 958749 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1177 (cluster) 958751 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Grant GA., 2018, Elucidation of a Self-Sustaining Cycle in Escherichia coli l-Serine Biosynthesis That Results in the Conservation of the Coenzyme, NAD., Biochemistry 57(11):1798-1806

 [2] Gu P., Yang F., Su T., Li F., Li Y., Qi Q., 2014, Construction of an L-serine producing Escherichia coli via metabolic engineering., J Ind Microbiol Biotechnol 41(9):1443-50

 [3] Ivancic T., Jamnik P., Stopar D., 2013, Cold shock CspA and CspB protein production during periodic temperature cycling in Escherichia coli., BMC Res Notes 6:248

 [4] Mundhada H., Schneider K., Christensen HB., Nielsen AT., 2016, Engineering of high yield production of L-serine in Escherichia coli., Biotechnol Bioeng 113(4):807-16

 [5] Smallbone K., Stanford NJ., 2013, Kinetic modeling of metabolic pathways: application to serine biosynthesis., Methods Mol Biol 985:113-21

 [6] Wintermute EH., Silver PA., 2010, Emergent cooperation in microbial metabolism., Mol Syst Biol 6:407

 [7] Zhang Y., Ma C., Dischert W., Soucaille P., Zeng AP., 2019, Engineering of Phosphoserine Aminotransferase Increases the Conversion of l-Homoserine to 4-Hydroxy-2-ketobutyrate in a Glycerol-Independent Pathway of 1,3-Propanediol Production from Glucose., Biotechnol J :e1900003

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB