RegulonDB RegulonDB 10.7: Gene Form
   

serS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dmsA rarA serS Fis ModE IHF NarL Fis NarL NarL Fis FNR TSS_1098 (cluster) TSS_1098 (cluster) TSS_1097 TSS_1097 TSS_1096 TSS_1096 TSS_1095 TSS_1095 TSS_1094 TSS_1094 dmsAp2 dmsAp2 TSS_1093 TSS_1093 dmsAp1 dmsAp1 TSS_1091 TSS_1091 TSS_1090 TSS_1090 TSS_1089 TSS_1089 TSS_1088 (cluster) TSS_1088 (cluster) TSS_1087 TSS_1087 TSS_1086 TSS_1086 TSS_1085 TSS_1085 serSp serSp TSS_1083 TSS_1083

Gene      
Name: serS    Texpresso search in the literature
Synonym(s): ECK0884, EG10947, b0893
Genome position(nucleotides): 939428 --> 940720 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.67
External database links:  
ASAP:
ABE-0003038
CGSC:
169
ECHOBASE:
EB0940
OU-MICROARRAY:
b0893
PORTECO:
serS
REGULONDB:
b0893
STRING:
511145.b0893
M3D: serS
COLOMBOS: serS
PortEco: b0893


Product      
Name: serine—tRNA ligase
Synonym(s): SerRS, SerS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.414
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
268 -> 270 RSE
228 -> 406 DTSNYALIPTAEVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRPEDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISSCSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENY
237 -> 239 TAE
1 -> 107 MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQAKARGEDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLP
355 -> 355 E

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0004828 - serine-tRNA ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006412 - translation
GO:0006418 - tRNA aminoacylation for protein translation
GO:0006434 - seryl-tRNA aminoacylation
GO:0016260 - selenocysteine biosynthetic process
GO:0097056 - selenocysteinyl-tRNA(Sec) biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35989N
ECOCYC:
SERS-MONOMER
ECOLIWIKI:
b0893
INTERPRO:
IPR002314
INTERPRO:
IPR002317
INTERPRO:
IPR006195
INTERPRO:
IPR033729
INTERPRO:
IPR010978
INTERPRO:
IPR015866
INTERPRO:
IPR042103
MINT:
MINT-1230011
MODBASE:
P0A8L1
PANTHER:
PTHR43697
PFAM:
PF02403
PFAM:
PF00587
PRIDE:
P0A8L1
PRINTS:
PR00981
PRODB:
PRO_000023935
PROSITE:
PS50862
PROTEINMODELPORTAL:
P0A8L1
REFSEQ:
NP_415413
SMR:
P0A8L1
UNIPROT:
P0A8L1


Operon      
Name: serS         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1083 939353 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1085 939422 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1086 939441 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1087 939732 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1088 (cluster) 939778 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1089 939783 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1090 940085 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1091 940406 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1093 940859 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1094 941064 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1095 941073 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1096 942273 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1097 942295 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1098 (cluster) 943010 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB