RegulonDB RegulonDB 10.7: Gene Form
   

maeA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeA adhP sra maeAp3 maeAp3 maeAp4 maeAp4 adhPp5 adhPp5

Gene      
Name: maeA    Texpresso search in the literature
Synonym(s): ECK1473, EG10948, b1479, sfcA
Genome position(nucleotides): 1553972 <-- 1555669 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.0
External database links:  
ASAP:
ABE-0004931
CGSC:
32176
ECHOBASE:
EB0941
OU-MICROARRAY:
b1479
PORTECO:
maeA
REGULONDB:
b1479
STRING:
511145.b1479
M3D: maeA
COLOMBOS: maeA
PortEco: b1479


Product      
Name: NAD+-dependent malate dehydrogenase
Synonym(s): MaeA, SfcA, malate dehydrogenase, NAD-requiring
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 63.197
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
81 -> 261 QDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYRRSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYTACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPDVLLQFEDFAQKNAMPLLNRYR
271 -> 530 IQGTAAVTVGTLIAASRAAGGQLSEKKIVFLGAGSAGCGIAEMIISQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRENLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPTSRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGASRITDEMLMSASETLAQYSPLVLNGEGMVLPELKDIQKVSRAIAFAVGKMA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004470 - malic enzyme activity
GO:0008948 - oxaloacetate decarboxylase activity
GO:0051287 - NAD binding
GO:0004471 - malate dehydrogenase (decarboxylating) (NAD+) activity
biological_process GO:0006090 - pyruvate metabolic process
GO:0006094 - gluconeogenesis
GO:0006108 - malate metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MALIC-NAD-MONOMER
ECOLIWIKI:
b1479
INTERPRO:
IPR023667
INTERPRO:
IPR012301
INTERPRO:
IPR012302
INTERPRO:
IPR015884
INTERPRO:
IPR036291
INTERPRO:
IPR037062
INTERPRO:
IPR001891
MODBASE:
P26616
PFAM:
PF00390
PFAM:
PF03949
PRIDE:
P26616
PRINTS:
PR00072
PROSITE:
PS00331
PROTEINMODELPORTAL:
P26616
REFSEQ:
NP_415996
SMART:
SM01274
SMART:
SM00919
SMR:
P26616
SWISSMODEL:
P26616
UNIPROT:
P26616


Operon      
Name: maeA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter adhPp5 1553994 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter maeAp4 1555727 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter maeAp3 1555742 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB