RegulonDB RegulonDB 10.7: Gene Form
   

slt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

slt ettA trpR TrpR CpxR trpRp trpRp TSS_5179 TSS_5179 sltp7 sltp7 TSS_5178 TSS_5178 yjjKp11 yjjKp11 TSS_5177 (cluster) TSS_5177 (cluster) TSS_5176 TSS_5176

Gene      
Name: slt    Texpresso search in the literature
Synonym(s): ECK4384, EG10950, b4392, sltY
Genome position(nucleotides): 4630733 --> 4632670 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.54
External database links:  
ASAP:
ABE-0014404
CGSC:
34819
ECHOBASE:
EB0943
OU-MICROARRAY:
b4392
PORTECO:
slt
REGULONDB:
b4392
STRING:
511145.b4392
M3D: slt
COLOMBOS: slt
PortEco: b4392


Product      
Name: soluble lytic murein transglycosylase
Synonym(s): Slt, Slt70, SltY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell wall,periplasmic space,membrane
Molecular weight: 73.353
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
478 -> 645 LAYNDLFKRYTSGKEIPQSYAMAIARQESAWNPKVKSPVGASGLMQIMPGTATHTVKMFSIPGYSSPGQLLDPETNINIGTSYLQYVYQQFGNNRIFSSAAYNAGPGRVRTWLGNSAGRIDAVAFVESIPFSETRGYVKNVLAYDAYYRYFMGDKPTLMSATEWGRRY
1 -> 27 MEKAKQVTWRLLAAGVCLLTVSSVARA
492 -> 582 EIPQSYAMAIARQESAWNPKVKSPVGASGLMQIMPGTATHTVKMFSIPGYSSPGQLLDPETNINIGTSYLQYVYQQFGNNRIFSSAAYNAG
407 -> 472 TQGPEMARVRELMYWNLDNTARSEWANLVKSKSKTEQAQLARYAFNNQWWDLSVQATIAGKLWDHL
505 -> 505 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0009274 - peptidoglycan-based cell wall
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008933 - lytic transglycosylase activity
GO:0008932 - lytic endotransglycosylase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0009253 - peptidoglycan catabolic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Beachey EH., et al., 1981
[2] Betzner AS., et al., 1989
[3] Blackburn NT., et al., 2001
[4] Heidrich C., et al., 2002
[5] Keck W., et al., 1985
[6] Korsak D., et al., 2005
[7] Kraft AR., et al., 1999
[8] Kusser W., et al., 1980
[9] Mett H., et al., 1980
External database links:  
CAZY:
GH23
ECOCYC:
EG10950-MONOMER
ECOLIWIKI:
b4392
INTERPRO:
IPR037061
INTERPRO:
IPR000189
INTERPRO:
IPR008258
INTERPRO:
IPR012289
INTERPRO:
IPR023346
INTERPRO:
IPR008939
MODBASE:
P0AGC3
PDB:
1SLY
PDB:
1QTE
PDB:
1QSA
PFAM:
PF01464
PFAM:
PF14718
PRIDE:
P0AGC3
PRODB:
PRO_000023956
PROSITE:
PS00922
PROTEINMODELPORTAL:
P0AGC3
REFSEQ:
NP_418809
SMR:
P0AGC3
SWISSMODEL:
P0AGC3
UNIPROT:
P0AGC3


Operon      
Name: slt         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5176 4630555 reverse nd [RS-EPT-CBR] [10]
  promoter TSS_5177 (cluster) 4630564 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [10]
  promoter yjjKp11 4630566 reverse Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter TSS_5178 4630567 reverse nd [RS-EPT-CBR] [10]
  promoter TSS_5179 4632698 forward nd [RS-EPT-CBR] [10]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Beachey EH., Keck W., de Pedro MA., Schwarz U., 1981, Exoenzymatic activity of transglycosylase isolated from Escherichia coli., Eur J Biochem 116(2):355-8

 [2] Betzner AS., Keck W., 1989, Molecular cloning, overexpression and mapping of the slt gene encoding the soluble lytic transglycosylase of Escherichia coli., Mol Gen Genet 219(3):489-91

 [3] Blackburn NT., Clarke AJ., 2001, Identification of four families of peptidoglycan lytic transglycosylases., J Mol Evol 52(1):78-84

 [4] Heidrich C., Ursinus A., Berger J., Schwarz H., Holtje JV., 2002, Effects of multiple deletions of murein hydrolases on viability, septum cleavage, and sensitivity to large toxic molecules in Escherichia coli., J Bacteriol 184(22):6093-9

 [5] Keck W., Wientjes FB., Schwarz U., 1985, Comparison of two hydrolytic murein transglycosylases of Escherichia coli., Eur J Biochem 148(3):493-7

 [6] Korsak D., Liebscher S., Vollmer W., 2005, Susceptibility to antibiotics and beta-lactamase induction in murein hydrolase mutants of Escherichia coli., Antimicrob Agents Chemother 49(4):1404-9

 [7] Kraft AR., Prabhu J., Ursinus A., Holtje JV., 1999, Interference with murein turnover has no effect on growth but reduces beta-lactamase induction in Escherichia coli., J Bacteriol 181(23):7192-8

 [8] Kusser W., Schwarz U., 1980, Escherichia coli murein transglycosylase. Purification by affinity chromatography and interaction with polynucleotides., Eur J Biochem 103(2):277-81

 [9] Mett H., Keck W., Funk A., Schwarz U., 1980, Two different species of murein transglycosylase in Escherichia coli., J Bacteriol 144(1):45-52

 [10] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [11] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB