RegulonDB RegulonDB 10.9: Gene Form
   

speC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speC nupG yqgH CRP ppGpp speCp speCp

Gene      
Name: speC    Texpresso search in the literature
Synonym(s): ECK2960, EG10961, b2965
Genome position(nucleotides): 3107020 <-- 3109155 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.2
External database links:  
ASAP:
ABE-0009730
CGSC:
159
ECHOBASE:
EB0954
ECOLIHUB:
speC
NCBI-GENE:
947457
OU-MICROARRAY:
b2965
STRING:
511145.b2965
COLOMBOS: speC


Product      
Name: constitutive ornithine decarboxylase
Synonym(s): SpeC, ornithine decarboxylase, biosynthetic
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 79.416
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
4 -> 94 MNIAASSELVSRLSSHRRVVALGDTDFTDVAAVVITAADSRSGILALLKRTGFHLPVFLYSEHAVELPAGVTAVINGNEQQWLELESAACQ
101 -> 543 PPFYDTLTQYVEMGNSTFACPGHQHGAFFKKHPAGRHFYDFFGENVFRADMCNADVKLGDLLIHEGSAKDAQKFAAKVFHADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKSNHHGALIQAGATPVYLEASRNPFGFIGGIDAHCFNEEYLRQQIRDVAPEKADLPRPYRLAIIQLGTYDGTVYNARQVIDTVGHLCDYILFDSAWVGYEQFIPMMADSSPLLLELNENDPGIFVTQSVHKQQAGFSQTSQIHKKDNHIRGQARFCPHKRLNNAFMLHASTSPFYPLFAALDVNAKIHEGESGRRLWAECVEIGIEARKAILARCKLFRPFIPPVVDGKLWQDYPTSVLASDRRFFSFEPGAKWHGFEGYAADQYFVDPCKLLLTTPGIDAETGEYSDFGVPATILAHYLRENGIVPEKCDLNSILFLLTPAESHEK
568 -> 697 LPSVYNKYPVRYRDYTLRQLCQEMHDLYVSFDVKDLQKAMFRQQSFPSVVMNPQDAHSAYIRGDVELVRIRDAEGRIAAEGALPYPPGVLCVVPGEVWGGAVQRYFLALEEGVNLLPGFSPELQGVYSET

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0004586 - ornithine decarboxylase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0008295 - spermidine biosynthetic process
GO:0033387 - putrescine biosynthetic process from ornithine
External database links:  
DIP:
DIP-10907N
ECOCYC:
ORNDECARBOX-BIO-MONOMER
ECOLIWIKI:
b2965
INTERPRO:
IPR036633
INTERPRO:
IPR011193
INTERPRO:
IPR015421
INTERPRO:
IPR015422
INTERPRO:
IPR015424
INTERPRO:
IPR027464
INTERPRO:
IPR008286
INTERPRO:
IPR005308
INTERPRO:
IPR000310
INTERPRO:
IPR011006
MODBASE:
P21169
PFAM:
PF01276
PFAM:
PF03711
PFAM:
PF03709
PRIDE:
P21169
PRODB:
PRO_000023973
PROSITE:
PS00703
REFSEQ:
NP_417440
SMR:
P21169
UNIPROT:
P21169


Operon      
Name: speC         
Operon arrangement:
Transcription unit        Promoter
speC


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB