RegulonDB RegulonDB 10.7: Gene Form
   

speD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speE speD yacL speDp speDp

Gene      
Name: speD    Texpresso search in the literature
Synonym(s): ECK0119, EG10962, b0120
Genome position(nucleotides): 134788 <-- 135582 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.16
External database links:  
ASAP:
ABE-0000416
CGSC:
158
ECHOBASE:
EB0955
NCBI-GENE:
947719
OU-MICROARRAY:
b0120
PORTECO:
speD
REGULONDB:
b0120
STRING:
511145.b0120
M3D: speD
COLOMBOS: speD
PortEco: b0120


Product      
Name: S-adenosylmethionine decarboxylase proenzyme
Synonym(s): SpeD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.385
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
33 -> 169 DGYIAYIDELYNANRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYRVRG
112 -> 264 SHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV
1 -> 111 MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPETVVAHLDK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0004014 - adenosylmethionine decarboxylase activity
biological_process GO:0008152 - metabolic process
GO:0006596 - polyamine biosynthetic process
GO:0008295 - spermidine biosynthetic process
GO:0006557 - S-adenosylmethioninamine biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-47936N
ECOCYC:
SPED-MONOMER
ECOLIWIKI:
b0120
INTERPRO:
IPR003826
INTERPRO:
IPR009165
INTERPRO:
IPR016067
PANTHER:
PTHR33866
PFAM:
PF02675
PRIDE:
P0A7F6
PRODB:
PRO_000023974
PROTEINMODELPORTAL:
P0A7F6
REFSEQ:
NP_414662
SMR:
P0A7F6
UNIPROT:
P0A7F6


Operon      
Name: yacC-speED         
Operon arrangement:
Transcription unit        Promoter
speD
speE
yacC-speED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB