RegulonDB RegulonDB 10.7: Gene Form
   

speE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speE speD yacC speEp speEp speDp speDp

Gene      
Name: speE    Texpresso search in the literature
Synonym(s): ECK0120, EG10963, b0121
Genome position(nucleotides): 135598 <-- 136464 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.75
External database links:  
ASAP:
ABE-0000418
CGSC:
17590
ECHOBASE:
EB0956
NCBI-GENE:
947726
OU-MICROARRAY:
b0121
PORTECO:
speE
REGULONDB:
b0121
STRING:
511145.b0121
M3D: speE
COLOMBOS: speE
PortEco: b0121


Product      
Name: spermidine synthase
Synonym(s): SpeE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.321
Isoelectric point: 5.448
Motif(s):
 
Type Positions Sequence
2 -> 288 AEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQPS
140 -> 141 DG
162 -> 162 P
163 -> 163 I
60 -> 239 EFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0004766 - spermidine synthase activity
GO:0042803 - protein homodimerization activity
GO:0010487 - thermospermine synthase activity
GO:0016768 - spermine synthase activity
GO:0043918 - cadaverine aminopropyltransferase activity
biological_process GO:0006596 - polyamine biosynthetic process
GO:0008295 - spermidine biosynthetic process
External database links:  
DIP:
DIP-10908N
ECOCYC:
SPERMIDINESYN-MONOMER
ECOLIWIKI:
b0121
INTERPRO:
IPR001045
INTERPRO:
IPR037163
INTERPRO:
IPR035246
INTERPRO:
IPR029063
INTERPRO:
IPR030373
INTERPRO:
IPR030374
MINT:
MINT-1231846
MODBASE:
P09158
PANTHER:
PTHR11558
PDB:
3O4F
PFAM:
PF17284
PRIDE:
P09158
PROSITE:
PS01330
PROSITE:
PS51006
PROTEINMODELPORTAL:
P09158
REFSEQ:
NP_414663
SMR:
P09158
UNIPROT:
P09158


Operon      
Name: yacC-speED         
Operon arrangement:
Transcription unit        Promoter
speD
speE
yacC-speED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB