RegulonDB RegulonDB 10.8: Gene Form
   

speF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speF potE ybfK ybfI speFL potEp1 potEp1

Gene      
Name: speF    Texpresso search in the literature
Synonym(s): ECK0681, EG10964, b0693
Genome position(nucleotides): 718262 <-- 720460 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.34
External database links:  
ASAP:
ABE-0002362
CGSC:
31559
ECHOBASE:
EB0957
OU-MICROARRAY:
b0693
PortEco:
speF
STRING:
511145.b0693
COLOMBOS: speF


Product      
Name: inducible ornithine decarboxylase
Synonym(s): SpeF, ornithine decarboxylase, degradative
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 82.416
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
109 -> 551 PPFFRALVDYVNQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEALFRADLCNADVAMGDLLIHEGAPCIAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLTPGDLVLFDRNNHKSNHHGALLQAGATPVYLETARNPYGFIGGIDAHCFEESYLRELIAEVAPQRAKEARPFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCSPLLLDLNENDPGILVTQSVHKQQAGFSQTSQIHKKDSHIKGQQRYVPHKRMNNAFMMHASTSPFYPLFAALNINAKMHEGVSGRNMWMDCVVNGINARKLILDNCQHIRPFVPELVDGKPWQSYETAQIAVDLRFFQFVPGEHWHSFEGYAENQYFVDPCKLLLTTPGIDARNGEYEAFGVPATILANFLRENGVVPEKCDLNSILFLLTPAEDMAK
576 -> 705 LPSIYKQHEERYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKEHFPRVSMNPQEANYAYLRGEVELVRLPDAEGRIAAEGALPYPPGVLCVVPGEIWGGAVLRYFSALEEGINLLPGFAPELQGVYIEE
4 -> 103 LKIAVSDSCPDCFTTQRECIYINESRNIDVAAIVLSLNDVTCGKLDEIDATGYGIPVFIATENQERVPAEYLPRISGVFENCESRREFYGRQLETAASHY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0004586 - ornithine decarboxylase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0008295 - spermidine biosynthetic process
GO:0071468 - cellular response to acidic pH
GO:0033387 - putrescine biosynthetic process from ornithine
Note(s): Note(s): ...[more].
Reference(s): [1] Gale EF. 1940
[2] Kanjee U., et al., 2012
[3] Morris DR., et al., 1983
[4] Peng S., et al., 2014
[5] Shaibe E., et al., 1985
[6] Soksawatmaekhin W., et al., 2004
[7] Tkachenko AG., et al., 2012
External database links:  
DIP:
DIP-154N
ECOCYC:
ORNDECARBOXDEG-MONOMER
ECOLIWIKI:
b0693
INTERPRO:
IPR011193
INTERPRO:
IPR036633
INTERPRO:
IPR027568
INTERPRO:
IPR027464
INTERPRO:
IPR000310
INTERPRO:
IPR005308
INTERPRO:
IPR008286
INTERPRO:
IPR011006
INTERPRO:
IPR015421
INTERPRO:
IPR015422
INTERPRO:
IPR015424
MODBASE:
P24169
PFAM:
PF03711
PFAM:
PF03709
PFAM:
PF01276
PRIDE:
P24169
PRODB:
PRO_000023975
PROSITE:
PS00703
REFSEQ:
NP_415220
SMR:
P24169
UNIPROT:
P24169


Operon      
Name: speFLF-potE         
Operon arrangement:
Transcription unit        Promoter
speF-potE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter potEp1 718344 reverse Similarity to the consensus
Read more >
[ICWHO] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gale EF., 1940, The production of amines by bacteria: The decarboxylation of amino-acids by strains of Bacterium coli., Biochem J 34(3):392-413

 [2] Kanjee U., Ogata K., Houry WA., 2012, Direct binding targets of the stringent response alarmone (p)ppGpp., Mol Microbiol 85(6):1029-43

 [3] Morris DR., Boeker EA., 1983, Biosynthetic and biodegradative ornithine and arginine decarboxylases from Escherichia coli., Methods Enzymol 94:125-34

 [4] Peng S., Stephan R., Hummerjohann J., Tasara T., 2014, Transcriptional analysis of different stress response genes in Escherichia coli strains subjected to sodium chloride and lactic acid stress., FEMS Microbiol Lett 361(2):131-7

 [5] Shaibe E., Metzer E., Halpern YS., 1985, Control of utilization of L-arginine, L-ornithine, agmatine, and putrescine as nitrogen sources in Escherichia coli K-12., J Bacteriol 163(3):938-42

 [6] Soksawatmaekhin W., Kuraishi A., Sakata K., Kashiwagi K., Igarashi K., 2004, Excretion and uptake of cadaverine by CadB and its physiological functions in Escherichia coli., Mol Microbiol 51(5):1401-12

 [7] Tkachenko AG., Akhova AV., Shumkov MS., Nesterova LY., 2012, Polyamines reduce oxidative stress in Escherichia coli cells exposed to bactericidal antibiotics., Res Microbiol 163(2):83-91

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB